| reproxl.nl | Repro XL | ReproXL is located in Sint-Michielsgestel and specializes in high-quality reprographical products and services. Customers can visit here for blueprints, printing and printing services, and various forms of wall decorations such as canvas prints and posters. The website provides information about the history of ReproXL, the focus on quality, service and price, and contact details for questions and orders. | Design & Creative → Graphic Services 1003 | canvas print 14 blueprint 145 poster 837 print 5511 | North-Brabant → Sint-Michielsgestel 870 |
| escherinzoetermeer.nl | The M.C. Escher Company | The website does not focus on Escher the artist, as there is already plenty of information available about his work. It centers on the bond between Escher and a Zoetermeer family of Dorp, and the sale of his farm with 54 hectares of land. The website also describes the contact that Escher maintained with this family until his death in 1972 and the collaboration with various people, including Gerhard ten Hoopen, Jan Kragt, Judith Kadee, and The M.C. Escher Company, to place a plaque commemorating his time in Zoetermeer. | Dentistry → Dental Hygienist 651 | plaque 69 farm 2622 artist 5745 family 6462 | Utrecht → Baarn 1628 |
| rikuskoops.nl | rikuskoops | The website offers graphic work, including paintings, drawings, and collages, along with information about their sale. Furthermore, rikuskoops presents philosophical and scientific insights, including texts about Spinoza and other relevant topics. Additionally, the website provides archives of walks around Deventer, organized by month. | Culture → Philosophy 2057 | philosophy 570 texts 1218 walk 2161 work 3122 art 3856 | |
| alohasignandart.nl | Aloha Sign & Art | Aloha Sign & Art specializes in lettering various objects, including cars, plates, and windows. The website describes the application of photos to glass, often using transparent film and lamination, to transform spaces and evoke memories. The company focuses on delivering personalized decorative solutions with photos, with the customer's emotion at the center. | Decor & Furnishings → Wall Decor 1035 | plate 787 glass 2919 photo 7778 car 10865 design 27202 | |
| cartoons-tekenen.nl | cartoons-tekenen.nl | The website describes cartoons as drawn images with a humorous character, ranging from comic strips to animated films and caricatures. It explains that drawing cartoons doesn’t need to be difficult and that it is possible for almost everyone to learn this. The text mentions well-known cartoon characters (such as Donald Duck and Mickey Mouse) and Dutch cartoon artists (Gummbah, Ruben L. Oppenheimer, Gregorius Nekschot), as well as museums, magazines, awards, and websites related to cartoons. | Hobbies → Creative Hobbies 412 | comic strip 13 caricature 72 cartoon 160 humor 353 drawing 1101 | |
| kreasie.nl | kreasie | The bureau provides services including logo design for startups and complete solutions for businesses, such as business cards and catalogs. With a modern large format printer, kreasie can quickly produce posters, even in small runs, and also offers stickers in various formats. Services include printing orders in various formats, from A4 to window stickers. | Graphic Design → Stickers 277 | business card 270 stickers 777 poster 837 logo 4660 print 5511 design 27202 | |
| picture-design.nl | Ed Vink Picture Design | The website provides a wide range of high-quality wall decor to help customers transform their interiors. Ed Vink Picture Design also offers professional photography services, for artwork or other photographic needs. The website includes a portfolio of work and general terms and privacy statements. | Decor & Furnishings → Wall Decor 1035 | wall decor 213 canvas 694 gallery 1983 portfolio 6854 photography 9503 | South-Holland → Vlaardingen 1853 |
| hisgis.nl | HisGIS | The website presents several projects, including the ‘Leeuwarden Time Machine’, which allows users to take a journey through the history of Leeuwarden with historical maps and data. Various regional datasets, such as HisGIS Coast Zone North Holland and HisGIS 1832 Breda and surroundings, have been made available per date and provide access to historical cadastral data and heritage documents. The website encourages volunteer work and organizes presentations about the available historical datasets, such as the launch of HisGIS 1832 for the South Holland Coast Zone on January 17, 2020. | Computer Science → Geographic Information Systems (GIS) 66 | maps 331 city 1875 data 5872 | De Fryske Marren → Balk 224 |
| printmijnstad.nl | Printmijnstad | The website offers various product options, including city posters, star posters, zodiac posters, and phone cases, which can all be customized. Customers can specify their own text and layout for posters and phone cases, and there are various style options available for the designs. Printmijnstad emphasizes the quality of its products, its Dutch production, and offers free shipping and high customer satisfaction (8.8 on Trustpilot). | Graphic Design → Poster Design 27 | phone case 114 puzzle 811 poster 837 city 1875 style 2348 design 27202 | |
| batgerel.nl | Yumi Batgerel | Yumi Batgerel is a 3D Character Artist & Designer based in The Netherlands, dedicating her efforts to producing diverse digital products. The portfolio features projects including study figures, sculpting, and blog posts related to 3D character art. Several game projects are listed, such as 'Sisters of the Gold Vein', 'The Rider Silverdragon', 'The CreedSower', and 'The Legend of King Arthur'. | Visual Arts → 3D Art 33 | brotherhood 77 sculpting 171 designer 571 portfolio 6854 | |
| lavistique.nl | Lavistique | The website offers a variety of pet portraits, including different costumes and styles, starting from €39.95. The ordering process is simple and involves choosing a style, uploading a photo, and receiving a preview within 48 hours, with the option for modifications. Lavistique also offers pet illustrations in various styles and provides contact information, shipping details, return policies, and privacy statements. | E-Commerce → Pet Supplies 1013 | pet 1617 style 2348 illustration 2447 portrait 3685 photo 7778 | Netherlands → Groningen 23734 |
| atlasvanstolk.nl | Atlas Van Stolk | The collection includes approximately one and a quarter million objects, including photos, drawings, engravings and posters. This collection has been recognized by UNESCO Netherlands as part of the ‘Netherlands Memory of the World Register’ due to its social importance. Visitors can search and view the collection, with detailed information about the objects, such as creator, text and date. | Local History → Dutch History 1067 | object 270 archive 2067 illustration 2447 image 2605 collection 7566 photo 7778 | |
| plint.nl | Plint | Plint has existed for over 40 years and exclusively publishes the most beautiful poems, combined with artwork from visual artists or illustrators, resulting in poetry posters. The poetry posters are not permanently reprinted but get a second life in anthologies. They are also presented as poetry picture books or loose issues. In addition to poetry, Plint also offers products such as cards, notebooks, pens, tea, and art objects, both physically and digitally. | Art & Culture → Art Events 327 | visual art 136 poetry 665 paper 770 poster 837 card 1975 | |
| studio26.nl | Studio26 | Studio26 believes in the power of creativity and uses it to connect and inspire people. The organization organizes over 100 performances and events annually in various regions, including Arnhem, Doetinchem, and on festival grounds such as Mariënwaerdt. Studio26 offers education in the field of performing arts, including workshops and full-fledged training programs, and also focuses on amateur art and the rental of its premises for various purposes. | Industry & Business → Record Labels 111 Initiatives & Projects → Nonprofits 750 | label 819 creativity 2531 space 3846 education 13471 event 45199 | Rheden → Velp 700 |
| ijber.nl | IJBer | The site offers a glimpse into the personal artistic practice of IJBer, a multi-disciplinary artist, with a particular focus on the theme ‘The poetry of flowers in the field’. IJBer explores the complexity of natural order and cooperation, as visible in the growth and blooming of plants in the field, and compares this to the way plants, animals, and humans maintain order in the world. In addition to artwork, the website also includes an archive of experimental photography, handmade books, and a blog, as well as links to other relevant projects and channels. | | graphic art 89 poetry 665 textile 1421 archive 2067 paintings 3907 blog 13392 | |
| printforce.nl | Printforce | The graphic market is dynamic and requires constant innovation, to which Printforce responds by collaborating with partners in warehousing, logistics, and distribution. Printforce offers both softcover and hardcover books, magazines, and journals on a made-to-order basis, with an online platform for product upload and ordering. The company is one of the largest players in the printing of magazines and scientific journals and strives for green and efficient production with a modern machine park. | Crafts → Embroidery 624 Digital Design & Graphics → Graphics 88 | machine park 642 magazine 2182 logistics 3257 book 11396 sustainability 18451 | |
| puntenel.nl | PUNTENEL | The website features a showcase of murals created by artists such as Kitty van B and Jeanne. Users can share their compliments and positive feedback on the website, which are displayed in a dedicated section. Puntenel.nl offers free and costless WordPress web-site hosting without requiring any payment. | Painting → Murals 125 | compliment 15 mural 338 | |
| telodelic.nl | Telodelic | The shop provides a selection of greeting cards in categories such as 'Reflections', 'Wild Nature' and 'Personal Growth'. A diverse range of greeting card themes are available, ranging from 'Earth to water' to 'Moving' and 'Looking Back'. The website is owned by Telodelic and registered for the year 2025. | Commerce → Greeting Cards 430 | copyright 255 greeting card 335 shop 6483 | |
| monsterkamer.nl | The Monster Chamber | The platform showcases a wide collection of paper and cover materials from international suppliers, along with examples of printing and graphic techniques. Professionals such as designers and publishers can benefit from services including paper advice and sample requests. Since 2011, The Monster Chamber has published interviews with designers discussing their favorite papers and sources of inspiration. | Printing & Production → Print Media 207 | designer 571 paper 770 print 5511 collection 7566 | North-Holland → Amsterdam 41253 |
| moodzdesign.nl | MOODZ design | The website sells various types of cards, including single, double, mini, card sets and zodiac cards. It also offers posters, such as garden posters and textile posters, which can be a decorative addition to any home. In addition to cards and posters, MOODZ design offers planners and stationery, as well as products related to school and ‘Teacher & Student’. | Graphic Design → Cards 442 | planner 237 stationery 286 poster 837 card 1975 | |
| quintart.nl | Quint Art | Customers can have their own photos printed on canvas, wood, aluminum, and other materials, and choose from a wide range of categories, such as animals, nature, and abstract art. Quint Art offers a broad assortment of materials to choose from, such as aluminum, dibond, forex, wood and cork, and also offers customization options. The website provides free shipping from €35, low prices, and quality that customers can rely on, along with a blog featuring interior design advice. | Decor & Furnishings → Wall Decor 1035 | art print 53 canvas 694 aluminum 1197 photo 7778 interior 8093 | |
| coszy.nl | Coszy | The website presents an online shop with various products, including wall decor featuring images of toucans, blue jays and hummingbirds in pixel art style. The founders, Janita and Kitty, share their passion for graphic art and entrepreneurship, and their story began in 2021. The website offers a gift card, shipping is free and payments run safely via Ideal or Afterpay. Attention is also paid to sustainable materials and clear service terms. | Decor & Furnishings → Wall Decor 1035 | wall decor 213 gift card 582 bird 922 color 4159 sustainability 18451 | |
| gt-etiketten.nl | GT Etiketten & Labels | The company was founded in 1988 by Gert, who began as a flexo printer and is now the general director of his family business. GT Etiketten offers both blank and full-color labels, using flexo and digital printing techniques. The company is located in Schoonebeek and utilizes energy-efficient UV LED machines to increase productivity and sustainability. | Office Supplies → Labels 199 | label 819 production 4582 print 5511 | Emmen → Schoonebeek 141 |
| studiosien.nl | Studio Sien | Studio Sien specializes in designing professional logos and brand identities, as well as various graphic expressions such as brochures and websites. The website also showcases a portfolio of paintings, characterized by layering, color, and powerful forms. Furthermore, creative workshops are offered that encourage participants to explore their inner world through artistic forms. | Design & Creative → Graphic Services 1003 | graphic work 21 brand identity 1457 paintings 3907 logo 4660 workshop 19325 design 27202 | |
| vulpenhuis.nl | t Vulpenhuis | The website presents a wide selection of brands, including Caran d'Ache, Cross, Conklin, Diplomat, Esterbrook, Faber-Castell, Fisher Space Pen, LAMY, and Kaweco. Various pen models are offered, ranging from standard pens to special space pens and models from Graf von Faber-Castell. The site warns visitors that JavaScript may be disabled and advises enabling it for optimal user experience. | Stationery → Pens 57 | fountain pen 15 pen 210 brand 17737 | |
| pppnederland.nl | PPP Nederland | The company has professionally wrapped a ferryboat in Amsterdam with high-quality stickers. PPP Nederland focuses on improving the visibility of products and brand images through innovative solutions and smart services. The organization invests in the client, their market, and is certified for quality, environment, and risk inventory and evaluation. | Merchandise & Retail → Stationery 576 Environment → Environmental Sustainability 83 | visuals 207 certification 3380 print 5511 | North-Holland → Amsterdam 41253 |
| gahilversum.nl | Graphic Atelier Hilversum | The workshop provides facilities and materials for various graphic techniques, including screen printing, etching, litho, letterpress, toyobo, and photography. The atelier organizes courses and workshops for different levels, from introductory to more advanced techniques. Schools can also use the facilities. The Graphic Atelier Hilversum manages an extensive collection of graphic heritage, including old printing presses and machines, and makes this accessible to the public. | Arts & Culture → Arts Subjects 64 | letterpress 28 etching 48 screen printing 128 heritage 818 course 14728 workshop 19325 | North-Holland → Hilversum 4397 |
| harryvankruiningen.nl | Harry van Kruiningen Foundation | The website contains an overview of his oeuvre, including paintings, graphics, etchings, and mosaic sculptures, with details about specific works and their locations. Information is provided about exhibitions where works by van Kruiningen can be seen, including an event in the Amsterdam Court of Justice and the Amsterdam Museum. The website also offers the possibility to order biographies, oeuvres catalogs, and greeting cards, as well as to subscribe to the newsletter. | | oeuvre 66 etchings 76 graphics 123 biography 697 paintings 3907 exhibition 5332 | |
| kurpershoekmanuel.nl | kurpershoekmanuel.nl | Manuel Kurpershoek is a visual artist and printer who practices various forms of art. His work includes woodcuts, graphics, and diverse artworks, including series and projects with titles such as 'Chaplin,' 'Three Brushstrokes,' and 'View'. Kurpershoek has held exhibitions in Ubbergen (expo Ubbergen 1, expo Ubbergen 2, expo Ubbergen 3) and in Genk. | | woodcut 45 graphic 74 series 644 artwork 2248 exhibition 5332 | Berg en Dal → Ubbergen 55 |
| thefutureofexhibitions.nl | Mogelijk | The atlas is a dynamic project that adapts to new insights and geographical changes. The site offers various possibilities, including discovering information, registering dossiers, and participating in a community platform. Users can subscribe to a newsletter to stay up-to-date on developments. | Galleries & Exhibitions → Exhibitions 1083 | atlas 69 exhibition 5332 sustainability 18451 | |
| benkersaan.nl | Ben Kersaan | Ben Kersaan is an artist working with diverse mediums, including graphic art, landscapes, oil pastels, drawings, and flat paintings. The website contains information about recent exhibitions, such as a group exhibition in Papenburg (Germany) and a recent award with the Velazquez & Goya Prize in Barcelona. In addition to exhibitions and publications, the website also offers courses and educational activities, and details the rights of the artwork. | Painting → Various Techniques 11 | graphic art 89 series 644 landscape 2609 exhibition 5332 artist 5745 | |
| janssenpers.nl | Janssen/Pers Rotatiedruk | Janssen/Pers Rotatiedruk is the largest independent newspaper printing company in the Netherlands, founded in 1883 and having grown to a company with more than 100 employees and a significant position in the Benelux. The company specializes in newspaper printing and retail folders, delivering approximately 11 million newspapers and millions of commercial products weekly, and possesses a modern machine park. Janssen/Pers Rotatiedruk is a wholly-owned subsidiary of Koninklijke Drukkerij Em. de Jong, a European printing company with an international customer base in the Netherlands, Germany, Belgium, and France. | Technical Services → Dutch Companies 42 | newspaper 396 machine park 642 publisher 757 print 5511 | Limburg → Gennep 574 |
| klinkhamerreclame.nl | Klinkhamer Reclame | The company offers a wide range of services, such as design, lettering, screen printing, and glass processing, and can help clients transform ideas into finished products. Klinkhamer Reclame focuses on personalized advice, expertise, and on-location service, providing services like car wrapping and supplying workwear. The website describes the processes behind car wrapping and boat wrapping, emphasizing the protective and personalization aspects of these services. | Websites → Crafts 41 | carwrapping 127 advertising 2302 design 27202 | Drenthe → Meppel 1903 |
| edojan.nl | Edo-Jan Meijer | Edo-Jan Meijer is a Dutch designer, photographer and artist who graduated from the Design Academy Eindhoven in 1998. Following his studies, he developed himself as a concept developer and designer, and at the age of 27 he was diagnosed with MS (Multiple Sclerosis). This led him to view the world from a new perspective and focus on personal interpretation and fulfillment of life. The website offers a portfolio of his artwork (portraits, digital drawings, abstract art, photography, landscapes, wildlife), graphic designs, blog articles, publications, and exhibitions. The site also provides information about motivational speeches and collaboration with the National MS Foundation. | Galleries → Online Galleries 225 Galleries & Exhibitions → Exhibitions 1083 | artwork 2248 exhibition 5332 artist 5745 photography 9503 design 27202 | |
| gerhuntjens.nl | HuntArt | The website offers an overview of his diverse oeuvre, including cartoons, engravings, paintings, and design products. Since 2022, the work of Gèr Huntjens (excluding his paintings) has been archived at the RKD Netherlands Institute for Art History in The Hague. Gèr Huntjens was also known under the pseudonym ‘Hunt’ and published his cartoons in various Dutch and German weekly magazines, as well as in Switzerland, Belgium, and France. | Literature → Literary History 19 | oeuvre 66 cartoon 160 paintings 3907 artist 5745 design 27202 | South-Holland → The Hague 19898 |
| janvanderschalie.nl | wprevolutie.nl | Jan van der Schalie has created screen prints and analog photos as personal hobby projects. Previously he worked as a photographer and in the graphic design industry, specializing in advertising and product photography. The screen prints are based on earlier black and white photographs, developed in the graphic workshops of the SKVR in Rotterdam and the MESH print club in Rotterdam. | Personal Expression → Hobby Photography 20 | screenprint 42 photographer 1366 photo 7778 | South-Holland → Rotterdam 25048 |
| printsupport4u.nl | PrintSupport4U | PrintSupport4U offers a wide range of printing products, including the creation of books, brochures, dissertations and calendars. The company guides customers through the entire printing process, from design to finishing and logistics, and specializes in the production of magazines, brochures and other graphic materials. PrintSupport4U also offers a ‘do-it-yourself’ option, Boekendeal, for smaller runs, where customers can make their own choices within a selected range of options. | Books → Publishers 1040 | certificate 1036 magazine 2182 print 5511 design 27202 | |
| marijaarntzen.nl | Marij Aarntzen | The site offers an overview of her graphic art work, dating from 2000 to the present. Marij Aarntzen has created paintings in various periods, from 1990 to 2020. The website presents a chronological overview of her paintings and graphic art productions. | Galleries & Exhibitions → Artwork 41 | graphic art 89 artwork 2248 paintings 3907 | |
| reklameallerlei.nl | Reclame Allerlei | The website was started in 1970 by Willem and Carmela Theunissen, who transitioned from their painting background to the advertising industry after maintaining signage and car lettering. With the digitalization, terms like Sign and Signmaker have become common, following the rise of PCs and CAD systems in the 1980s used for cutting self-adhesive letter foils. Currently, Reclame Allerlei offers digital printing and cutting techniques for durable signage and lettering, with a wide range of fonts and full-color prints. | Graphic Design & Printing → Typography 82 | car advertising 19 font 71 signage 838 advertising 2302 print 5511 | |
| saskiaschreven.nl | Saskia Schreven Vormgeving & Illustratie | The website showcases various projects including school murals, circus decorations, birth cards and children's books, often with a playful and colorful style. Saskia Schreven offers a variety of services, such as screen printing, portraits and graphic designs for various applications including infographics and calendars. The website includes a shop (Shop) where patterns, coloring pages and other creative products are for sale, as well as information about projects and contact details. | Visual Arts → Drawing 1046 | graphics 123 coloring pages 138 mural 338 pattern 2012 illustration 2447 design 27202 | North-Brabant → Eindhoven 11845 |
| grafischcentrumgroningen.nl | Stichting Grafisch Centrum Groningen | The workshop facilitates artists who work freely here and offers a wide range of courses, leading many people to develop a passion for graphic techniques. The centre organises the annual Kopperprent, a prize-winning graphic print, and celebrates its 60th anniversary in 2022-2023. The workshop is equipped with presses that have been in use for 60 years and was founded in the 1960s by members of De Ploeg, with the aim of combining a love of graphics with collaborative creative work. | Arts & Culture → Arts Subjects 64 | lithography 25 letterpress 28 etching 48 course 14728 | Netherlands → Groningen 23734 |
| wapenschilder.nl | Heraldisch Atelier Bultsma | The atelier specializes in hand-painted heraldry, as opposed to computer-generated images. Clients can come for the design of their family coat of arms, but also for broader heraldic art, such as church seals and flags. Piet Bultsma-Vos is an experienced heraldic artist and member of several recognized organizations, such as the Hoge Raad van Adel and the Society of Heraldic Arts. | Imaging & Photography → Creative 187 History → Social Sciences 10786 | heraldry 12 arm 17 coat of arms 42 art 3856 design 27202 | |
| philipsreclamekunst.nl | Kunst in de Philips-reclame | The website contains a collection of advertising items, including posters and images, often copies of the original materials. Biographical information is available for artists, designers, and advertising agencies involved in the Philips advertising campaigns. In addition to the collection of advertising items, the website offers information about the history of art in Philips advertising, related books, and exhibitions, and other relevant links. | Museums & Collections → Company History 27 | copies 11 advertising materials 46 biography 697 agency 944 advertising 2302 exhibition 5332 | |
| historischetopografie.nl | historischetopografie.nl | The site focuses on the research into artists and collectors of topographical images, starting with collections compiled in the 18th century, such as those by Brouërius van Nidek, which encompassed the entire country. Andries Schoemaker played a significant role as a patron of a new, documentary school of topographical artists, while De Haen and Craandijk later became influential in the field. The content of the site is based on the research of the author and collaborators, and comments and additions are welcome from visitors. | Dutch History → 18th Century 12 | topography 15 atlas 69 collector 157 manuscript 197 archive 2067 artist 5745 | |
| oudefotosvandongen.nl | Heemkundekring Dongen | The website contains a comprehensive collection of images, organized by topography and photo, with topics such as the tram, wartime years, and the shoe industry. There are also special pages dedicated to history books, maps, class photos, and references to publications. Visitors are encouraged to submit their own photos via the contact page, and the website promotes respectful use of the provided materials. | Web → Internet 16456 | topography 15 postcard 278 printer 634 history 7286 photo 7778 | North-Brabant → Dongen 851 |
| mauricekummer.nl | Maurice Kummer | Maurice Kummer creates unique graphic portraits of women with meticulous detail and passion. The website provides an overview of his works, including symbolic, erotic, and mythical themes, and sculptures made of wood and other materials. The site also features short stories, a biography, and information about upcoming exhibitions. | Painting → Individual Artists 668 | sculpture 1440 portrait 3685 paintings 3907 theme 4015 exhibition 5332 story 8285 | |
| indocomics.nl | Baltimore Publications | The book ‘Indocomics’ details the impact of Indonesian comic artists on the development of comics, based on research by Ruud den Drijver. Quotes from various critics and experts praise the book as insightful, engaging, and a treasure. The website provides navigation to videos, contact information, privacy policy, ordering options, cookie policy, and links to related organizations such as Stichting Pelita and Baltimore Publications. | Arts → Comics & Illustration 283 | comic 59 study 720 video 6714 book 11396 | |
| hetbeeldlokaal.nl | Atelier het Beeldlokaal | The atelier is located in the old craft school of Leeuwarden and organizes both general courses and special workshops. New courses and workshops are planned for the 2025-2026 academic year, available online. The website provides information on various printing techniques, including etching, pinhole photography and stencil printing, and contains testimonials from former students who praise the quality of the lessons and the guidance of Yvonne Feijten. | Conceptual & Interactive Art → Art Forms 492 | cyanotype 11 printing technique 85 atelier 1417 photography 9503 course 14728 workshop 19325 | Southwest-Friesland → Koudum 134 |
| canvas-fotokunst.nl | Canvas Fotokunst | The website offers a wide range of canvas paintings and photographic art for various applications, such as living room decor and office backgrounds. Customers can choose from various materials such as plexiglass, wood, or aluminum, and the company offers free shipping within the Netherlands, Belgium, and Germany. Currently, large tripanels are no longer available for order, but the website offers a wide selection of canvas cloths and tripanels that can be used as wall decorations. | Decor & Furnishings → Wall Decor 1035 | canvas 694 wall 1378 art 3856 paintings 3907 interior 8093 | |
| studiohartsuiker.nl | Studio Hartsuiker | The website focuses on providing custom-made letterpress wedding stationery, emphasizing the handcrafted quality and personal touch of each piece. Studio Hartsuiker utilizes traditional techniques like letterpress and foil stamping, alongside luxurious materials, to produce timeless and tactile stationery that serves as a 'tangible glimpse' for guests. The website offers a range of products, including save-the-dates and vow books, and provides contact information for inquiries. | Merchandise & Retail → Stationery 576 | letterpress 28 invitation 204 stationery 286 craftsmanship 1858 wedding 4258 design 27202 | |
| annemargreetniemeijer.nl | Anne–Margreet Niemeijer | The portfolio features a range of illustrations and surface patterns, including character designs, floral patterns, and depictions of sea creatures. Anne–Margreet Niemeijer offers her designs on platforms like Spoonflower for fabric and wallpaper, as well as through her own shop. The website includes a blog, sketchbook, and various product offerings, such as bookmarks, cards, and coloring pages. | Arts & Culture → Arts Subjects 64 | sketchbook 33 handlettering 45 pattern 2012 illustration 2447 portfolio 6854 | |
| agalab.nl | AGA LAB | The workshop, recognized as one of the oldest of its kind, plans to reorganize and become an artist-run space, involving artists directly in the management. AGA LAB is currently seeking 20 artists to form a base group and support the workshop. Membership costs 200 euros per month and provides access to the facilities. The website offers information about workshops, an agenda, print-on-demand services, an ‘Artist in Residence’ program, and the terms and conditions of membership. | | print 5511 artist 5745 membership 10442 workshop 19325 | |
| atelierrond.nl | Atelier Rond | René Maagdenberg creates art at Atelier Rond in Meppel, including paintings, sculptures, illustrations, murals, and photomanipulations. The studio is also the source of his graphic work and the place where he develops poetry and prose, sometimes even music. René’s paintings reflect his fascination for mankind and its place in the world, often with a paradoxical combination of abstract and realistic styles, with material choices varying depending on the moment and subject. | Painting → Contemporary Painting 452 | graphic work 21 mural 338 poetry 665 illustration 2447 paintings 3907 | Drenthe → Meppel 1903 |
| street-art.nl | streetart.nl | Mando Marie, an American artist residing in Amsterdam, graduated from the Rocky Mountain College of Art and Design and utilizes a combination of traditional painting methods and stencils in her work, inspired by ‘Golden Books’ and 70s comic books. The website presents a limited edition of 10 ASVP silkscreens, including ‘Donkey Head’, which combines elements of graphic illustrations, the advertising world, and pop culture. Streetart.nl, in collaboration with Andenken Gallerie, offers a limited edition of 10 ASVP silkscreens, with ‘Donkey Head’ as an iconic image of the artist duo. | | duo 328 illustration 2447 work 3122 artist 5745 | North-Holland → Amsterdam 41253 |
| grafischatelieralkmaar.nl | Grafisch Atelier Alkmaar (GAA) | The GAA has been located at Doelenstraat 23 in Alkmaar since 1975. The gallery regularly displays work by graphic artists, and the work is for sale, with a price list available. The workshop offers various graphic techniques such as lithography, screen printing, and etching, with available equipment, materials, and the possibility of bookbinding. | Visual Arts → Museums 2049 Artists & Studios → Galleries 1398 | printmaking 40 gallery 1983 technique 2157 print 5511 workshop 19325 | |
| gadenbosch.nl | Grafisch Atelier Den Bosch | The workshop provides various services, including custom printing, printing courses, and a talent hub for young artists. The website contains information about opening hours, upcoming courses (such as screen printing and Toyoboprint), and examples of previous printing work for various clients. Visitors can also commission their own printing, subscribe to the newsletter, volunteer, or view job vacancies. | Services → Textile Industry 116 | makerspace 30 talent 3987 print 5511 course 14728 | North-Brabant → 's-Hertogenbosch 8868 |
| artisbook.nl | Stichting ARTisBOOK | The foundation organizes various activities, including an archive space, ARTisMEMBER programs, publications, and educational initiatives. The 2024-2025 program will focus on the theme of travel, with presentations, performances, and lectures being presented. The foundation is taking a break for the summer, but will return with the next edition of Bookshelf VI on October 25th, 2025. | Art Management & Sales → Art Organizations 255 | graphic work 21 publication 2018 exhibition 5332 | |
| schwantz.nl | Klaver Illustratie & strips | The site offers illustrations, comics, posters, and other artworks by Mr. Mack, including the ‘Little Red Riding Hood’ project and ‘Cardboard a Go Go’. Mr. Mack creates various artworks, including mostly textless comics and cardboard sculptures and digital art. The website includes information about the company, including the KvK registration number, VAT number, contact details, and general terms and conditions. | Arts → Comics & Illustration 283 | comic 59 cardboard 170 artwork 2248 illustration 2447 | North-Holland → Haarlem 8674 |
| fi-donc.nl | Fi Donc | The website offers a wide collection of animation art, including stills, artistic editions, and collectibles of Disney and other artists. A key component of the website is the Walt Disney Classics Collection (WDCC), which provides explanations and information about this collectible series. Fi Donc is a Dutch specialist in animation art, established in 1994 and recognized as the oldest in the country. | Hobbies → Collectibles 773 | disney 55 collectibles 118 artist 5745 | |
| kismanstudio.nl | Kismanstudio | The website features various artworks, including posters for the Moving Gallery in Utrecht, screen prints like 'Nosedive' and 'Duikvlucht,' and silkscreen prints such as 'La Côte Picarde.' Kismanstudio has been designing posters for the Moving Gallery since 2019, with upcoming exhibitions planned for June/July 2025. They also created a cover for the Volkskrant magazine in May 2025. The website includes a shop where prints and silkscreens can be purchased, alongside links to newsletters and collaborations with artists like Ate von Hes for the project 'De__Steil,' exploring rhythmic visuals and audio. | Visual Arts → Printmaking 302 | poster 837 artwork 2248 print 5511 newsletter 6504 | Netherlands → Utrecht 48901 |
| marcelvankan.nl | Marcel Vankan | The portfolio features works ranging from 3D-printed diplomas and medals to handcrafted carpets, postcards, and design objects. Marcel Vankan has worked on projects for various museums and artists, including Atelier Ted Noten, the Stedelijk Museum Amsterdam, and the Zuiderzee Museum. The website also highlights educational experiences, such as lectures and lessons at educational institutions in the Netherlands and Japan. | Education & Training → Educational Software 274 | medal 213 postcard 278 diploma 795 exhibition 5332 design 27202 | North-Holland → Uithoorn 940 |
| reinoudvanvught.nl | Reinoud van Vught | Reinoud van Vught's paintings are characterized by the interaction between paint and chance, interspersed with more deliberate interventions. He often creates organic and floral motifs by working on the paint streaks and weathered paper surfaces, inspired by nature and traditional painting. The website is owned by Reinoud van Vught and contains information about his work and copyright information. | Painting → Contemporary Art 805 | motif 42 paintings 3907 inspiration 4081 paint 8747 | |
| cardvision.nl | Card Vision | The website offers a wide range of plastic cards, including white, colored, and full-color variants, as well as various card printers and accessories. Card Vision focuses on various sectors, including governments, commercial service providers, SMEs, retail, and other organizations, and delivers both small and large quantities of cards. The website provides information on products, offers, technical support and contact options, emphasizing 20 years of expertise in the field. | Design & Creative → Graphic Services 1003 | printer 634 card 1975 print 5511 package 6112 accessories 12975 | |
| aljaspaan.nl | Alja Spaan | The site features a blog with excerpts from her writing and personal reflections, including poems and prose. There is an archive of diary entries, specifically from July 20th to 23rd, 2025, and a diary archive. The website provides access to graphic design work by Alja Spaan and a literary walk in Alkmaar, with supplementary information about the route and quotations from her work. | Merchandise & Retail → Stationery 576 | diary 212 quotation 253 writing 1504 publication 2018 graphic design 2042 walk 2161 | North-Holland → Alkmaar 6507 |
| kalligrafie.nl | Mary Koperdraat Calligraphy | Mary Koperdraat is a calligrapher with 35 years of experience in the field. She offers services such as calligraphy of diplomas, certificates, and texts in Golden Books, as well as the creation of unique collages. Her collages, measuring 16 cm x 21.5 cm, are for sale for € 25.00 each. Contact information can be found via the contact form. | Textile Arts → Calligraphy 80 | calligraphy 69 collage 262 diploma 795 texts 1218 artwork 2248 | Utrecht → Amersfoort 8011 |
| dneend.nl | Atelier DneenD & DuckDesign | Leo Kaldenbach is a graphic artist specializing in high-pressure techniques and experimenting with various materials to create unique graphic series. Since 1976, he has been active as an artist within Atelier DneenD and, since approximately 15 years ago, has been working with his friend and colleague Bernard Winkel in the artist collective WinKal, creating spatial art. The website presents a selection of his graphic works, including titles, dimensions, and prices, and offers insights into his previous exhibitions, including a show at Print Gallery Pieter Brattinga in Amsterdam and Japan. | | graphic art 89 exhibition 5332 collection 7566 | Coevorden → Aalden 74 |
| onlineposterkopen.nl | ONLINE POSTER KOPEN | The website offers a wide range of wall decor in various styles, including Scandinavian design, flower posters, and movie star posters, and features custom-made designs. Users can choose from categories such as bathroom posters, kitchen posters, children's posters, and a wide range of other themes, including nature posters, city posters and text posters. The website also offers additional services such as poster lists, digital gift cards and customer service with a contact form and FAQ. | Decor & Furnishings → Wall Decor 1035 | wall decor 213 list 575 poster 837 style 2348 collection 7566 | |
| vanikke.nl | vanIkke.nl | The shop offers a wide range of wall stickers in various themes, including vehicles, flowers, birds, and animals. In addition to wall stickers, vanIkke.nl also sells full-color retro applications that can be glued onto clothing, with both mini and XL versions. The website provides instructions for applying the stickers and applications, and also includes information about the terms and conditions and an FAQ. | Decor & Furnishings → Wall Decor 1035 Decor & Furnishings → Wall Stickers 22 | wall stickers 55 childrens room 104 postcard 278 application 3377 clothing 9443 | |
| stephandesmet.nl | Book & More Books Edtions | The website contains information about projects such as ‘Buried in and around the Walburgis Church’ and ‘The Mood in the Middle’, as well as a new year’s card and a collection of other publications and artworks. A key element is the focus on the Walburgis Church in Zutphen, with a description of its long and fascinating history. Stephan de Smet works with other artists and graphic designers, such as Pieter Bijwaard and Pé Okx, and regularly publishes new works under the auspices of Book & More Books Edtions and NoorderPost. | Religious Studies → Religious History 217 | mural 338 publisher 757 | Gelderland → Zutphen 2690 |
| bienvanheek.nl | Bien van Heek | The site features a wide range of artwork, including lino prints inspired by works of renowned artists such as Anselm Kiefer, Francis Bacon, and Pablo Picasso. Bien van Heek also presents work under the categories of ‘Ruimtelijk’ (Spatial), ‘Bootverhalen’ (Boat Stories), ‘Zwemmers’ (Swimmers), and ‘Kleitabletten’ (Clay Tablets). The website includes an overview of ongoing and recent projects and exhibitions, as well as a personal ‘About Me’ section. | Visual Arts → Printmaking 302 | animation 1777 paintings 3907 artist 5745 | North-Holland → Amsterdam 41253 |
| griffioen-grafiek.nl | Griffioen Grafiek | The website showcases a wide collection of graphic art, including sheet music, film and magazine covers, political prints, and original sketches. Griffioen Grafiek specializes in the work of Joost Swarte and possesses a broad selection of work by other comic artists, such as Ever Meulen and Charles Burns. The website offers an online shop with a collection of Joost Swarte's work and organizes exhibitions featuring thousands of prints from the period 1860-1960. | Home → Antiques & Collectibles 1523 | publisher 757 drawings 1329 gallery 1983 work 3122 print 5511 collection 7566 | |
| thoets.nl | Graphic Collective Thoets | The collective consists of five members: Jan Baas, Ina Brekelmans, Steven Toes, Ellen Huijsmans, and Edwin Emmens. The website presents details of various exhibitions, including the submissions of the IPMAP25 - Connect Open Call in Eindhoven and the Grafiektriënnale. Thoets also organizes Open Days, where the annual member print is presented, and there is a musical performance and children's book presentation. | Galleries & Exhibitions → Exhibitions 1083 | graphic 74 open day 205 exhibition 5332 member 10154 book 11396 music 13170 | North-Brabant → Eindhoven 11845 |
| cartoonvonk.nl | Berend Vonk | Berend Vonk is an artist who performs a wide range of drawing work, including cartoons, illustrations, comic stories, woodcuts, screen printing, and etchings. He has a long history of making cartoons, illustrations, and corporate impressions, starting in 1991. He has won various awards for his art, including the Ilse Frankenthal prize for woodcuts and the first prize for illustration of the city of Amsterdam, and his comic albums have been repeatedly awarded and listed among the best comic albums. | Arts → Comics & Illustration 283 | woodcut 45 comic 59 cartoon 160 illustration 2447 art 3856 | |
| marijkeduffhauss.nl | Marijke Duffhauss | The website displays a bibliography including various works, such as books and cartoons titled 'The World’s Biggest Grandpa,' 'It’s Summer!', 'It’s Winter,' 'Rose Finds a Glasses,' 'Lotte Wants a Puppy,' 'A Journey to Bethlehem,' 'The Richest Grandpa,' and 'The Spring Book'. There are also calendars of Jan & Noortje from 2009 and 2010 available, as well as cartoons with titles such as ‘Panic in School’ and ‘The Storm in Nimir’s Garden’. The website also contains references to various publishers, authors, and illustrators, such as Jongbloed Publishing, Den Hertog, Van Holkema & Warendorf, Bookscout, Ambo-Anthos, and Unieboek. | Arts & Culture → Art Education 594 | cartoon 160 publisher 757 calendar 1556 illustration 2447 portrait 3685 book 11396 | |
| natuurlijkverbeelden.nl | Janet Borghuis | The studio produces linocuts, screen prints, etchings and silkscreen prints in small editions and offers a direct look at techniques such as high pressure, pressure printing, monotype and relief printing. The website provides information about the available techniques, the sizes of the images and the location of art markets and studio routes, including the Leersum Art Studio Route and Zeist Art Route. Janet Borghuis regularly organizes exhibitions at art markets and studio routes, and offers the opportunity to view her work in her studio. | Artists → Studios 152 Graphic Design & Printing → Typography 82 | art market 69 printing technique 85 graphics 123 route 3425 studio 5465 | Zeist → Hoge Dennen 12 |
| vethgedrukt.nl | VETH gedrukt | Maarten Giltay Veth is the owner and printer of VETH gedrukt, a printing workshop he established in 2022 at his home. The workshop specializes in the production of handmade graphic art, small publications, and invitations using woodcut, metal type, clichés, ornaments, and linocuts. VETH gedrukt is part of a larger initiative, Mooi Marginaal, which is published by Stichting Laurens Janszoon Coster and promotes the most beautiful Dutch and Flemish bibliophilic and marginal publications. | Graphic Design & Printing → Typography 82 | woodcut 45 printing technique 85 graphic art 89 invitation 204 publication 2018 | |
| hannekebarendregt.nl | Hanneke Barendregt | Hanneke Barendregt graduated from the St Joost Academy in Breda in 2006, where she focused on graphic art. Her work has evolved from wall graphics to spatial projects, incorporating wood and glass. Her work is influenced by architecture. She experiments with techniques such as glass casting and sand casting, and also creates wooden bookhouses that connect with her graphic art. | Sculpture → Art Objects 48 | graphic art 89 glass 2919 architecture 3223 wood 4153 | North-Brabant → Breda 9003 |
| tobivanringen.nl | Tobi Van Ringen | Tobi Van Ringen is a visual artist with a particular interest in space. His work focuses on the tension between space and borders, using minimal interventions to challenge the viewer to reflect. The website offers a selection of his objects, spatial compositions, monoprints, and photographic work. | Planning & Development → Spatial Planning 889 | monoprints 14 border 119 objects 426 space 3846 photography 9503 design 27202 | |
| viktorhachmang.nl | Viktor Hachmang Studio | The website features the 'Positions: Gut Feeling' exhibition graphic identity, a project for Travis Geertruida, which describes a graphic novel titled ‘L’Arpenteur’ about a marooned man searching for his home in a desolate landscape. It also highlights several scarf designs for Hermès, including ‘Hermès Metallique’ and ‘Robocabar’, intended for Spring/Summer menswear collections of 2024 and 2025. Furthermore, the site displays the book design for ‘Flower Factory’ by Richard Foster, a novel set in Noordwijkerhout, Netherlands, drawing inspiration from the region’s flower bulb industry and personal memories. | | graphic novel 16 book design 68 illustration 2447 | Noordwijk → Noordwijkerhout 1099 |
| mycartoon.nl | My Cartoon | The website offers the possibility to create a personalized pet portrait in over 80 different styles. Various options for pet portraits are available, ranging from simple portraits to larger compositions with multiple pets. In addition to portraits, My Cartoon also sells costumes, illustrations, and decorative items such as photo tiles, rugs, and 3D statues. | Crafts → Embroidery 624 Dogs → Supplies 1005 | costume 500 pet 1617 artwork 2248 portrait 3685 | |
| karensaaman.nl | Karen Saaman | Karen Saaman creates graphic art using stamps, colored pencils, scissors, and glue. She makes stamp compositions, prints, and drawings, often using text to tell stories, both abstract and concrete. Karen uses letterpress and other printing techniques, and is open to digital editing of stamp work, such as creating designs for relief printing. | Graphic Design & Printing → Typography 82 | letterpress 28 stamp 88 drawing 1101 print 5511 design 27202 | Gelderland → Nijmegen 9384 |
| alaleen.nl | Alaleen | Leen van der Heijdt is an illustrator and graphic designer who provides visual communication services. Her illustrations, consisting of watercolor and linocut, are used to bring texts to life and convey a specific atmosphere. As a graphic designer, she offers services such as designing logos and brand identities, with a focus on structure and consistency. | Illustration → Illustrators 178 | linocut 31 watercolor 369 brand identity 1457 graphic design 2042 illustration 2447 | |
| shesacatartworks.nl | She's a Cat Art Works | The business specializes in airbrush techniques on trucks, cars, motorcycles, walls, RC trucks, prostheses, and miniatures. They provide custom paint services, including customizing aircraft, restoring rusty vehicles, and creating rust and rust look effects. In addition, they also operate wall paintings, ceiling paintings, body paint, portraits, gold leaf application, and therapeutic aids (prostheses), as well as offering lessons and workshops. | Artists → Freelance Artists 25 Retail & Commerce → Retailers 754 | wall paintings 18 airbrush 52 restoration 3417 portrait 3685 | Stede Broec → Grootebroek 212 |
| busselunited.nl | Bussel United | The webshop offers diverse products, such as stickers, cards, tote bags, notebooks and mugs, with a special focus on items related to animals (dachshund, cats, hamsters) and mental health (depression, burnout, autism). The founders, Tommie and Kelly of Bussel, are partners who have been working together since 2008 and married in 2014. Their shop is a reflection of their interests and the challenges they face. The webshop attempts to create openness about difficult topics and serves as a ‘safe space’ for people who experience similar challenges. | Graphic Design → Stickers 277 Office Supplies → Labels 199 | mental health 400 stickers 777 card 1975 illustration 2447 animal 2908 accessories 12975 | North-Holland → Hilversum 4397 |
| re-visie.nl | ReVisie Arsenaalgas 8B | ReVisie graphic design offers a fresh perspective on the brand identity of its clients. The bureau works with various graphic disciplines, including animation, art direction, photography, illustration, typography, and website development. ReVisie works closely with clients to develop a suitable brand style, logo, website, or other visual materials. | Film → Animation 868 | brand identity 1457 animation 1777 graphic design 2042 logo 4660 photography 9503 | Gelderland → Nijmegen 9384 |
| grafiekplatform.nl | Grafiekplatform | The association has existed since 1993 under the name VOG and has been called Grafiekplatform since 2019, bringing together artists, workshops, museums, galleries, publishers and collectors. Grafiekplatform organizes various projects, such as the Grafiektriënnale in Uppsala, Sweden, and participates in international networks, such as the Deutsch-Niederländisches Grafiknetzwerk. The website provides information about the association, its members, the RAAM graphic magazine, and the opportunity to become a member and be inspired by the world of contemporary graphic art. | Visual Arts → Printmaking 302 | graphic art 89 association 8562 member 10154 event 45199 | |
| flappiekids.nl | Flappie Kids | The site offers an overview of activities, hobbies, and leisure time options for children. News articles are also presented on topics such as VR technology in construction and the history of Lego. The website emphasizes the importance of creativity for children's development, both in terms of personal growth and education. | Hobbies → Creative Hobbies 412 | lego 341 creativity 2531 child 11566 | |
| studiomaria.nl | Studio Maria Digital Creative | Maria Hylarides is a photographer and graphic designer who lives in Rotterdam. Her photographs are available for purchase through various online platforms, including Werk aan de Muur, Artfully Walls, Society6, and Red Bubble. The website offers services such as design of posters, brand identities, and digital editing, as well as photography and digital editing workshops. | Commerce → Greeting Cards 430 | poster 837 online shop 1310 brand identity 1457 graphic design 2042 photography 9503 workshop 19325 | South-Holland → Rotterdam 25048 |
| kunstaanderandvannederland.nl | Kunst aan de rand van Nederland | The organization organizes annual studio routes, allowing visitors to visit the studios of artists. Kunst aan de rand van Nederland also organizes group exhibitions, such as an exhibition in the Bartholomeus Church in Beerta, which takes place from September 6th to October 2025. The organization was established in 2006 and is supported by Hans van Herwijnen and Ingrid Constance. | Graphic Design & Printing → Typography 82 | border 119 exhibition 5332 studio 5465 artist 5745 event 45199 | Groningen → East 315 |
| bobbioskam.nl | Bobbi Oskam | Bobbi Oskam has designed illustrations and covers for various publications, including articles for De Correspondent and the Volkskrant 'V'. She has also created and published Risograph prints, including a book titled 'Tele-Vue Horror Stories' and a tote bag design for Wolf Books & Printed Matter. Oskam has collaborated on projects such as Le Mini Who?, Magical Octopus, Gevelexpositie for Paradiso Amsterdam, and Bewaar De Zomer. | Books → Publishers 1040 | poster 837 illustration 2447 festival 3804 book 11396 design 27202 | |
| fernhoutdruk.nl | Florence Eliane Fernhout | Floor Fernhout is a graphic artist and painter who graduated in 2001 from the Hoge School voor de Kunsten in Arnhem, specializing in free art. The website presents an overview of her artworks, including series such as ‘2001’, ‘De verandering’ (The Change), and ‘Bureau’. The site also contains a gallery, information about her exhibitions, a contact form, a newsletter registration, and a guestbook. | Painting → Contemporary Art 805 | woodcut 45 gallery 1983 artwork 2248 portrait 3685 exhibition 5332 | |
| zenproducts.nl | ZenProducts | The site features a variety of illustrations and digital creations, including characters like 'Pug,' 'Monster in the Woods,' and 'Red Riding Hood'. It also offers design-related products and services, such as fonts ('fuzzy font') and packaging designs ('identity brewery', 'packaging brewery'). The website includes themed collections like ‘Infinite Journeys Challenge,’ and features references to various media and artistic styles, including animation, illustration, and typography. | Conceptual & Interactive Art → Conceptual Art 70 | font 71 character 449 packaging 2236 artwork 2248 illustration 2447 design 27202 | |
| rbbmr.nl | Rob Bömer | Rob Bömer is a graphic journalistic production specialist offering various services, including photography, photo-illustration, and design. The website features portfolios of projects such as AD VALVAS magazine, PIXEL photography (including aerial and landscape photography), VECTOR illustrations, and CAMPAGNES posters. Furthermore, the website provides information about the 100th anniversary of the Ons Lustoord garden park and an impression of the 5 JAAR AMSTELKWARTIER publication. | Illustration → Illustrators 178 | garden park 12 poster 837 magazine 2182 illustration 2447 photography 9503 design 27202 | North-Holland → Amsterdam 41253 |
| karikaturen-online.nl | karikaturen-online | The website offers various types of caricatures, including individual caricatures, duo caricatures, group caricatures, and caricatures of celebrities (BN/VIPs). Customers can order caricatures via email or book a quick artist for a personal performance or workshop. The website also contains information about prices, general terms and conditions, and tips for submitting good photos. | E-Commerce → Marketplaces 1053 | caricature 72 celebrity 78 bookings 523 photo 7778 workshop 19325 | |
| kontoerdesign.nl | Kontoer Design | The website sells various types of wall decor, including canvas prints, tapestries, and prints on plexiglass, offering options such as frames and spacers. Kantoer Design offers unique designs created in their own studio, with a wide range of artworks, including paintings and abstract motifs. Customers can choose their own design, determine the dimensions, and select the material to create a personalized wall decor, with the option to request samples and seek advice. | Decor & Furnishings → Wall Decor 1035 | tapestry 36 canvas 694 art 3856 paint 8747 design 27202 | |
| bosmagrafiek.nl | BosmaGrafiek | Marijn Bosma worked from 1993 to 2018 under the name BosmaGrafiek as a cartographic bureau, specializing in the design of thematic maps. Currently, he occasionally creates new overview maps and offers to create maps that quickly and clearly represent a subject. The copyrights on the maps and the name BosmaGrafiek are protected for a long period, requiring written permission from Marijn Bosma for reuse. | | copyright 255 map 801 plan 2566 theme 4015 | Gelderland → Nijmegen 9384 |
| papierknipmuseum.nl | Museum of Paper Cutting Art | Dutch paper cutting art has a unique history, without specific movements, where each cutter had their own style. Although the appreciation for paper cutting fluctuated over time, the artist's position was valued in the 17th and 18th centuries, and later primarily practiced in the lower classes. In the 20th century, artists such as Hill Bottema and Wiecher Tjeerd Lever worked to revive and bring new life to paper cutting, and the museum displays work by both well-known and lesser-known artists. | Visual Arts → Museums 2049 | museum 2002 work 3122 artist 5745 collection 7566 | |
| catch-online.nl | Catch Projecten | The website offers a wide range of artworks, including works by renowned artists such as Herman Brood, Corneille, Charles van den Broek, and Franco Costa. The shop also sells graduation gifts and offers a service for framing and project furnishing. The website is both physically located in Utrecht and online via a webshop, with an extensive search functionality to find artworks based on keywords, product type, artist, subject and more. | Visual Arts → Printmaking 302 | project furnishing 127 maps 331 poster 837 frame 883 art 3856 | Netherlands → Utrecht 48901 |
| chagall.nl | Chagall Gallery & Research Centre Wuyt | The site describes how visitors can make use of the knowledge about Marc Chagall and his oeuvre. The Chagall Gallery Wuyt, located in Amsterdam, has a stock of approximately five hundred lithographs, etchings, and woodcuts. The Chagall Research Centre offers services, including authenticity research for a fee, costing € 150,-. | Visual Arts → Art History 449 Painting → Contemporary Art 805 | graphic art 89 gallery 1983 publication 2018 event 45199 | North-Holland → Amsterdam 41253 |
| erik-mol.nl | Erik Mol | Erik Mol, born in Amsterdam in 1955, is a visual artist primarily focused on abstract art, concentrating on form and rhythm, and working according to intuitive principles. His work explores themes such as chance, chaos, and order, reflecting on the relationship between simplicity and complexity in the world. The website provides links to online images of his work and references his blog Molshoop. Furthermore, the site notes his involvement at Grafisch Atelier Friesland as a workshop assistant and volunteer in workshops. | Painting → Abstract Painting 594 | abstract art 43 graphics 123 objects 426 drawings 1329 paintings 3907 workshop 19325 | North-Holland → Amsterdam 41253 |
| markjanssenshop.nl | Mark Janssen Shop | The website sells art prints of the best illustrations from Mark Janssen’s children’s and picture books. The art prints are of high quality, printed on 310 grams thick paper with high colorfastness. Each art print is hand-signed by Mark Janssen himself. Coaching and paper & format are also offered. | | children’s book 41 art print 53 signature 60 illustration 2447 coach 25810 | Limburg → Valkenburg aan de Geul 1233 |
| gosterk.nl | GoSterk | Wytse Sterk is described as a highly skilled craftsman whose designs are visually striking and immediately recognizable as originating from his own creative process. He is lauded by multiple individuals for his artistic talent and unique style. The website highlights Sterk’s work in various mediums, including logo design, artwork, and posters, and he specifically caters to tattoo artists, bands, and festivals. His designs are characterized by bold symbolism and clarity. Several testimonials express admiration for Sterk's work, particularly his gig posters, which are described as exciting, impactful, and effectively promoting both events and artistic pieces. | Painting → Digital Art 820 | tattoo 799 poster 837 artwork 2248 logo 4660 artist 5745 design 27202 | North-Holland → Amsterdam 41253 |
| custtom.nl | Custtom | The site informs visitors who are experiencing problems with ordering due to an outdated browser version, and advises using a recent browser, such as Google Chrome. Custtom offers a wide range of products, including photos on canvas, prints, felt letters, framed photos, plastic posters, photo collages, world maps and gift cards. The website also includes customer reviews highlighting the quality and speed of delivery, as well as customer service. | | canvas 694 image 2605 photo 7778 | |
| tondekruijk.nl | Atelier and Gallery Ton de Kruijk | The website displays a selection of the artwork of Ton de Kruijk, ranging from landscapes and portraits to printed reproductions (giclée). Various exhibitions are presented, including the exhibition from May 10th to May 25th, 2025, and the exhibitions of 2023 and 2022. In addition to the artwork, there are information pages about the work methods, reviews, an agenda of events and offers for courses and workshops. | Painting → Digital Art 820 | giclée 15 atelier 1417 paintings 3907 exhibition 5332 course 14728 | Gooise Meren → Bussum 2201 |
| galerievanbokhoven.nl | Galerie van Bokhoven | The website provides an online gallery featuring the art of artist Bokhoven, with a focus on seascapes, portraits, and designs. Artwork is offered in limited editions, printed on museum-quality paper and lightfast, and personally signed. The website includes an online shop where artworks and portraits can be purchased, and a newsletter subscription option. | Painting → Realism 200 | artworks 460 drawings 1329 flowers 3248 portrait 3685 paintings 3907 shop 6483 | Bergen → Egmond aan Zee 362 |
| iwaarden.nl | Iwaarden | The company offers a wide range of services including interior renovation, glass decoration, wall coverings, acoustic solutions, wayfinding, facade styling, and light advertising, as well as art projects like murals and exhibitions. The company’s core values include creativity, integrity, an inviting attitude, empathy, and inspiration, and the synergy between traditional crafts and innovative printing techniques. Iwaarden has locations in Barneveld (headquarters and production) and Amsterdam (project bureau), and offers various product categories such as wall coverings, custom solutions for office interiors, signage for various applications, and artwork. | Painting → Murals 125 | wall covering 63 printing technique 85 signage 838 artwork 2248 decoration 4085 interior 8093 | Gelderland → Barneveld 2781 |
| marieketenberge.nl | Marieke ten Berge | Marieke ten Berge is an artist who draws inspiration from the beauty of nature, with a particular focus on Arctic regions and the animals that inhabit them. Her work includes illustrations for books, maps, art prints, and original artworks, often created using traditional graphic techniques such as etching and lino prints. The website features a portfolio of her work, an online shop with upcoming items for sale, information about her awards and nominations, and a list of her clients. | Visual Arts → Printmaking 302 | etching 48 illustration 2447 studio 5465 nature 9094 book 11396 | Ooststellingwerf → Oosterwolde 417 |
| metinkt.nl | MET INKT | The website details MET INKT's services, particularly the design and printing of cards with letterpress, an artisanal technique that is being revived in the 21st century. The site offers information about specific card types such as birth announcements, wedding invitations, and sympathy cards, including workflow procedures, order forms, and options for creating custom designs. The technique of letterpress is explained, highlighting the combination of traditional craftsmanship and modern digital imagery. | Design & Creative → Graphic Services 1003 | letterpress 28 card 1975 design 27202 | North-Holland → Haarlem 8674 |
| hofvanjan.nl | Hof van Jan | The Hof van Jan foundation was established in 2011 by four letterpress printers who share a workspace in Haarlem. The foundation has access to various printing presses and tools used for producing books and publications. Hof van Jan is open to collaboration with authors and artists, and publishes under different imprints. | Graphic Design & Printing → Typography 82 | imprint 13 letterpress 28 print 5511 foundation 6678 | North-Holland → Haarlem 8674 |
| grafischewerkplaatsamsterdam.nl | GWA Graphic Workshop Amsterdam | The workshop offers courses in letterpress, typography, woodcut, linocut, bookbinding and wood engraving. The aim is to get people, including artists, enthusiasts, students, and scholars, away from the computer and to learn the beauty of traditional printing techniques. GWA regularly organizes events such as talks and workshops with guest speakers and artists. | Crafts → Bookbinding 79 | letterpress 28 bookbinding 45 course 14728 workshop 19325 event 45199 | |
| finegraphic.nl | Fine Graphic | Fine Graphic produces artwork and graphic designs for various companies, from large to small clients, both nationally and internationally. The website offers a portfolio of graphic art and graphic design examples, including designs for print, web, and brochures. Fine Graphic provides services for designing artwork for offices, websites, and brochures, striving for a professional approach for every client. | Visual Arts → Printmaking 302 | graphic design 2042 artwork 2248 print 5511 portfolio 6854 | |
| sietskekoopman.nl | Sietske Alblas Koopman | Sietske Koopman has taken over her new studio at Westsingel in Goes in October 2023, after three years of renovations of a building in Het Huis Van De Maker. She graduated from the ArtEZ art academy in Zwolle in 2007 and has worked as a freelance artist since then. Her work is realistic but with a rough and playful style, emphasizing light, color, and the beauty of nature and human influence on the landscape. | Arts & Culture → Art Education 594 | art academy 19 graphic art 89 paintings 3907 light 5148 studio 5465 nature 9094 | Overijssel → Zwolle 7395 |
| scholingsfonds-kc.nl | Scholingsfonds KC | The website presents trending topics about art, including graffiti art and the ways in which everyone makes art. Information about art education and the processes involved in these programs is discussed. An article featuring an interview with artist Johan is presented, detailing his working methods and inspiration. | Arts & Culture → Art Education 594 | graffiti 243 fashion 2212 art 3856 studio 5465 music 13170 education 13471 | |
| cocvanduijn.nl | Replicaphotography | Coc van Duijn produces art and design, including decorative items to hang or place, and offers opportunities to contribute to the creative process. A significant part of her work involves printing linocuts on upholstery fabric salvaged from old textbooks, which are then transformed into bags and pouches. Furthermore, she produces linocut prints on paper, paints framed prints, and creates ceramics, such as plates and coasters, often featuring animal figures, and offers illustration and logo design services upon request. | Crafts → Ceramics 1156 | linocut 31 upholstery fabrics 49 textbook 73 ceramics 1271 illustration 2447 animal 2908 | South-Holland → The Hague 19898 |
| lalettrekalligrafie.nl | La Lettre Kalligrafie | The team at La Lettre Kalligrafie carefully designs luxury stationery for weddings, focusing on bridal couples who appreciate art and design and are looking for unique details. The webshop offers a wide range of luxury stationery and invitations. The website also includes a blog, general terms and conditions, and FAQs. | | invitation 204 stationery 286 wedding 4258 design 27202 | |
| tibosdecors.nl | Tibos Decors | The team, consisting of Eric Tibosch, Jesper van der Meer, Karin, and Jeroen Tapper, combines various disciplines to offer high-quality and creative solutions. They provide a diverse range of services, including murals, decorative work, floor paintings, and complete themed interiors with accompanying props and constructions. Eric Tibosch, the ‘Creative Decormeester,’ describes himself as a lover of beauty and a sensitive person, who is not primarily focused on commercial aspects, but on craftsmanship and creating unique concepts.” | Architecture & Design → Creative Industries 1157 | mural 338 decor 945 concept 3338 design 27202 | |
| lotkreeftenberg.nl | Lot Kreeftenberg beeldend kunstenaar | Lot Kreeftenberg’s creative process begins with determining whether to focus on the technique or the idea, and then developing the artwork. He explains that ‘brooding’ – the process of developing themes and ideas – is an essential part of his work. The artist currently explores themes such as polarization and the war in Ukraine, incorporating them into his art series. | Visual Arts → Printmaking 302 | monoprints 14 printmaking 40 artwork 2248 theme 4015 inspiration 4081 paint 8747 | |
| uwgeboortekaartspecialist.nl | Your Birth Announcement Specialist | The printing company offers a wide range of printing techniques, including offset printing, letterpress, foil printing, and laser cutting. They deliver birth announcements throughout the Netherlands and use various paper types, such as cotton paper and kraft paper. The printing company has 35 years of experience in printing birth announcements and has a large collection of designs and books with birth announcements. | Graphic Design → Cards 442 | paper type 37 birth announcement 73 printing technique 85 design 27202 | Vleuten - De Meern → Vleuten 574 |
| janssenrepro.nl | Janssen Repro Nijmegen | Janssen Repro began as a light printing and reproduction company and has since evolved to print on almost all types of materials and substrates. The printing services offered include printing scripts, photos, and documents, as well as digital prints such as posters, business cards, and brochures. Janssen Repro also offers specialized printing solutions such as textile prints for clothing and mugs, building blueprint copies and sticker prints. | Clothing → Men 744 Photography → Photo 204 | printing service 44 blueprint 145 stickers 777 poster 837 textile 1421 print 5511 | Gelderland → Nijmegen 9384 |
| teekenakademiemiddelburg.nl | Teeken Akademie | The website contains news about recent events, such as the opening of the City Sketching Class and the awarding of the Prize for Young Zeeland Drawing Talent. There is information about the history of the Teeken Akademie, which was founded in 1778, and its mission to keep the drawing history alive and promote drawing today. The website also provides access to an image bank and registers, as well as a blog with updates and information about drawing activities. | Visual Arts → Drawing 1046 | drawing 1101 exhibition 5332 | Zeeland → Middelburg 2342 |
| jpsairpaint.nl | JP Nijs | JP Nijs offers airbrush courses, starting from childhood and focusing on mastering the technique of airbrush guns. In addition to the courses, Nijs offers freelance services in the area of airbrushing, including portraits on linen, special paint for motorcycles and cars, and murals. The website also contains information about a tattoo studio, which Nijs has been running for 14 years and is linked to the website www.freakinkool.nl. | Artists → Freelance Artists 25 | airbrush 52 mural 338 tattoo 799 atelier 1417 portrait 3685 course 14728 | |
| gblijsten.nl | GB Lijsten | The website offers a wide range of products, including wood collections, design gift lists, and aluminum frames. The company exclusively supplies businesses that are professionally equipped to sell frames and related items. The website contains information about the team, news, environmental practices, and a service page with information about ordering and available products. | Digital Media & Design → Graphic Industry 65 | aluminum 1197 frames 2556 wood 4153 assortment 7799 | Ede → Lunteren 730 |
| herminesanders.nl | Hermine Sanders | The website provides an overview of the various techniques that Hermine Sanders uses in her work, such as graphic art, etchings, woodcuts, linocuts, and screen printing. A selection of her installations and clothing items can be seen, as well as silhouette self-portraits and other artworks. The website contains photos of her exhibitions, including photos from Lambooijhuis 2015, BArticamp 2014 and KunstenLandschap 2013, and a guestbook. | Visual Arts → Drawing 1046 | artworks 460 technique 2157 exhibition 5332 photo 7778 | |
| antje-veldstra.nl | Antje Veldstra Grafiek | Antje Veldstra, born in 1954 in Hindeloopen, Friesland, began her studies at the Minerva Art Academy only in 1979 after studying to become a microbiologist. Her interest in ancient civilizations, particularly the Etruscan culture in Italy, has greatly influenced her work. Through travels and stays in Tuscany and Sardinia in Italy, she developed a deep fascination with the Mediterranean world, which is reflected in her style. She is known for her woodcut technique and has won several awards for her graphic work. The website contains information about recent and upcoming exhibitions, including an exhibition in the Obergumer church in Winsum and a exhibition of Pilaarprenten in Pictura. | | woodcut 45 graphic 74 exhibition 5332 print 5511 travel 7210 | Southwest-Friesland → Hindeloopen 127 |
| boek-laten-drukken.nl | Book-laten-drukken.nl | Book-laten-drukken.nl, a book printing company located in Volendam, has been offering expert advice in bookmaking for almost 60 years. They provide a wide range of printing methods and binding options. They cater to both small and large print runs and offer various options for cover material, such as linen, leather, and fabric, as well as silver foil printing. The website allows users to request a quote, download free valuable tips, and receive professional book printing advice. | Business Development → Sales Consulting 94 | binding 70 cover 392 run 800 print 5511 book 11396 | |
| stripstudio.nl | Stripstudio | The studio offers services including live cartoons, workshops, illustrations, comics, and 2D animation. Since 2006, the studio has provided communication support to clients, businesses, and governments. The website contains information about the studio, its services, reasons to choose them, and contact information, including links to social media. | Performing Arts → Live Entertainment 384 | comic 59 cartoon 160 animation 1777 illustration 2447 event 45199 | |
| tholensterk.nl | Tholen Sterk | The website contains information about the Tholen Havendagen 2026, including the date and location. There are photos of previous events, such as the Havendagen 2016, the Langste Slingershow 2016 and the Historical Day 2016. The website offers news, a list of sponsors and information about the privacy and cookie policy of the organization. | | sponsorship 2686 newsletter 6504 photo 7778 event 45199 | Zeeland → Tholen 863 |
| fineartprintingnaarden.nl | FineArt Printing Naarden | The workshop offers the opportunity to view the various paper types from brands such as Hahnemühle and TIPA. FineArt Printing Naarden prints using the Giclée technology with the EPSON SureColor P20000 printer and UltraChrome ProInk ink. The website describes the benefits of this technology, such as exceptional print quality. The website provides information on delivery times, the availability of paper types in stock, and possible delays during holidays. | Communication & Content → Copying Services 40 | printer 634 paper 770 color 4159 print 5511 order 6912 | |
| tok-tok.nl | Tok-Tok | The website sells vintage Dutch design furniture, including a chair by the Dutch manufacturer De Toekomst. Wooden toys of various brands and ages are also offered. There are also antique books, primarily on natural history, and old prints of animals and plants, mainly birds and poultry. | Retail & Commerce → Commerce 8244 | bird 922 toy 2295 print 5511 furniture 8751 book 11396 design 27202 | |
| hartjes-stotzer.nl | Andrea Stötzer and John Hartjes | The website offers an online shop with prints and ceramics. It contains information about the work of Andrea Stötzer and John Hartjes, including graphic art, ceramics, and metal casting. Courses are offered in graphic art and manga drawing, with different time slots and prices. | Painting → Digital Art 820 | manga 23 graphic art 89 ceramics 1271 exhibition 5332 course 14728 workshop 19325 | |
| papyrussalus.nl | Papyrus Salus Prentrestauratie | The atelier restores artworks on paper, including etchings, engravings, lithographs, and woodcuts, for art dealers, institutions, and individuals. The focus is on the preservation, technical analysis, and research of works on paper, with particular attention to prints, lithographs, and other graphic techniques. The atelier offers various restoration techniques, such as patching damage, combating mold, and removing unnecessary backings or cellotape, while preserving the original colors. | Plastics → Manufacturing 7708 | etching 48 mold 356 paper 770 technique 2157 restoration 3417 | |
| edzerdillema.nl | Edzer Dillema | Edzer Dillema creates visual art using digital drawing programs, based on his previous experience as a graphic designer. The displayed works were created on a computer, but not by a computer, and are personally composed and colored by the artist. The artworks are printed in small editions on aluminum using sublimation printing. | Painting → Digital Art 820 | color palette 56 visual art 136 line 236 composition 639 software 8291 | |
| lindquist.nl | Drukkerij Lindquist | The printing company is a family business founded in Rotterdam in 1985 and located at Oosteinde in Rotterdam Kralingen since 1990. They offer a variety of printing services including business cards, stationery, envelopes, and folders, with a focus on quality and detail. Drukkerij Lindquist utilizes an antique Heidelberg degel to produce exclusive letterpress cards, a specialty of the studio. | Merchandise & Retail → Stationery 576 | letterpress 28 card 1975 color 4159 print 5511 design 27202 | Rotterdam → Prins Alexander 432 |
| sophiejarvinenpostma.nl | Sophie Järvinen Postma | The website contains an overview of various artworks, including drawings and pastel portraits. The works are arranged by date, with the most recent artworks at the top. A contact page is available for further information or any questions. | Visual Arts → Drawing 1046 | pastel 99 drawings 1329 artwork 2248 | |
| posterplaats.nl | ABC Posters | The website sells posters, postcards, and coloring pages, often featuring hand-drawn illustrations and unique designs. Several themes are available, including local areas such as Fryslân/Friesland, the Veluwe, and Sinterklaas. There are also posters with themes such as Bakken and Boerderij (Farm). The website offers various shipping and ordering options, including free shipping from €39,- and the possibility of pick-up. There are also discount codes and a gift voucher balance checker available. | Gifts → Gift Cards 981 | coloring pages 138 postcard 278 poster 837 customization 1723 theme 4015 | Bunschoten → Bunschoten-Spakenburg 382 |
| postertime.nl | PosterTime | The website offers a wide range of poster designs, including city maps, text posters, birthday and anniversary posters, and personal sketches. Customers can add their own text or images to the posters, and a sample design is always provided before the final poster is printed. PosterTime delivers the posters within four business days after approval, and offers an express print option for a faster delivery at an extra cost. | Design & Creative → Graphic Services 1003 | map 801 poster 837 wall 1378 occasion 2036 text 2467 design 27202 | |
| freekvanginkel.nl | Freek van Ginkel | The website features a comprehensive collection of Freek van Ginkel's work, categorized by period and art form. Van Ginkel's oeuvre includes paintings, graphic art, murals, and photography, with a particular emphasis on the ‘Mindscapes’ and ‘Colorfields’ series. The website offers an art rental service through depot Pijkestraat 21b. | Painting → Individual Artists 668 | art rental 36 graphic art 89 mural 338 paintings 3907 photography 9503 | |
| ruimteomteraken.nl | Ruimte om te raken | The website provides a platform for sharing stories, music, and artistic expressions centered around peace and love. The ‘Hearts2Connect’ project encourages visitors to share their own stories using specific hashtags, aiming to strengthen the power of peace and love. The organization has created a poster that can be shared to further spread the message of peace and love. | Social Issues & Welfare → Social Issues 18544 | hashtag 25 collective 256 poster 837 story 8285 music 13170 | |
| grafischewerkplaatsraaf.nl | Grafische Werkplaats RAAF | The workshop provides facilities for screen printing, relief printing, and intaglio printing, suitable for prints up to approximately A2 size. Regular workshops are organized covering various techniques such as screen printing, dry stamping, bookbinding, and linocut. A special proofing press, ‘De Vermijspers’, has recently been installed in the workshop, and a new price list is in effect. | Visual Arts → Printmaking 302 | linocut 31 screen printing 128 print 5511 workshop 19325 | |
| gerard-mulder.nl | Gerard Mulder | Gerard Mulder is an artist specializing in creating etchings, drawings and watercolors. He frequently paints cityscapes, particularly of Klarendal, and nature often inspires him. The website also includes videos, including a documentary about the ‘new time’ and artworks made from waste (waste art) and images of demonstrations and cannabis art. | Painting → Watercolor 274 | etchings 76 art 3856 paintings 3907 video 6714 nature 9094 | Arnhem → Klarendal 14 |
| herculessegersstichting.nl | Hercules Segers Stichting | The foundation focuses on promoting interest in contemporary print and drawing art by publishing books and organizing exhibitions. The website provides information about the foundation, its objectives, projects, funding opportunities, and administrative status. Currently, the exhibition of Han van Hagen is being presented in Museum Belvédère in Oranjewoud near Heerenveen, with a book about the prints of Hercules Segers available for purchase. | Visual Arts → Printmaking 302 | publication 2018 exhibition 5332 print 5511 | Heerenveen → Oranjewoud 64 |
| marcwiers.nl | marcwiers.nl | The website contains a portfolio of artworks, found under the category 'art / arte'. Several personal stories have been published, including 'Allein' (Alone), 'Story: Klassen' (Story: Classes), 'Story: Crisiskind' (Story: Crisis Child), 'Story: Scheiding' (Story: Separation) and 'Story: Armoede' (Story: Poverty). A short story describes an incident with a taxi driver in Berlin and the reaction to it in German society. | Freelancers → Writers 609 | berlin 59 separation 475 art 3856 portfolio 6854 story 8285 | Midden-Groningen → Siddeburen 108 |
| medical-art.nl | Rogier Trompert Medical Art | Rogier Trompert Medical Art is dedicated to creating medical and scientific illustrations and operates on a European scale. The company was founded in 1999 by Rogier Trompert, the first Dutch-certified medical illustrator, and boasts a wide client base including medical specialists, pharmaceutical companies, clinics, publishers, universities, and museums. The website describes a unique technique that combines photography with illustration to create photorealistic anatomical representations, emphasizing the approach to conveying complex information clearly and attractively to various audiences. | Disease & Treatment → Medicine 1017 | anatomy 70 medical information 87 audience 901 technique 2157 illustration 2447 | |
| zebrasaurus.nl | Zebrasaurus | Zebrasaurus designs children’s clothing with fun animal illustrations and produces them using organic cotton in a studio in Utrecht. The garments are printed with a sustainable screen printing process on high-quality organic cotton, often with a playful message encouraging children to pass them on. The website offers a selection of t-shirts, long-sleeved t-shirts, sweaters, and twinning shirts in various designs and colors, and provides free shipping over €100 within the Netherlands. | Men → T-Shirts 603 | screen printing 128 cotton 365 illustration 2447 clothing 9443 child 11566 design 27202 | Netherlands → Utrecht 48901 |
| stokwolf.nl | Stokwolf | The online shop sells a variety of products, including cards in different sizes, mini cards, prints, and card holders. There is a section dedicated to themes such as birds, flowers and plants, wetlands & meadows, forest, Christmas & winter, and various emotional categories such as 'happy', 'comforting', 'insightful' and 'festive'. The website also offers a selection of other products, such as pins & brooches and packaging materials, as well as a variety of birth cards with themes such as cats and dogs. | Decor & Furnishings → Wall Decor 1035 | postcard 278 bird 922 card 1975 flowers 3248 print 5511 | |
| grafiek2019.nl | Grafiek19 | The manifestation, featuring over 150 exhibitions, workshops, and lectures, takes place from September 1st to November 30th, 2019. The event offers a platform for artists, collectors, and enthusiasts of graphic art, with attention to both traditional printing techniques and digital innovations. The manifestation includes events such as an opening event, a national open studio day, and a symposium on digital innovation, with locations spread throughout the Netherlands. | Art & Culture → Art Events 327 | printing technique 85 graphic art 89 innovation 4659 exhibition 5332 artist 5745 event 45199 | Rotterdam → Center 382 |
| wonderzoet.nl | Wonderzoet | The website sells a diverse collection of products including printables, posters, and wallpapers, consciously designed to enjoy the moment. An e-book called ‘Wonderzoet Works – E-book De vliegende start van jouw webshop’ is offered. The website offers various categories, such as Christmas decorations, ‘Winter Wonderland’ wallpapers, and a selection of favorite products.” | Merchandise & Retail → Stationery 576 | printables 55 poster 837 e-book 1060 wallpaper 1756 collection 7566 design 27202 | |
| katarzynabaldyga.nl | Katarzyna Baldyga | The website features a portfolio of Katarzyna Baldyga's artwork, including paintings and wax sculptures. Notable pieces displayed include silkscreen prints and oil paintings, such as 'Starfish' and 'Light Sleep', as well as several untitled works. The collection spans from 2022 to 2024 and includes works held in the Collectie Rijksoverheid and Collection Museum Voorlinden. | Painting → Contemporary Art 805 | canvas 694 collection 7566 paint 8747 | North-Holland → Amsterdam 41253 |
| hallovogel.nl | Hallo Vogel | The website offers an online shop with wall paintings of various bird species, which are delivered to the customer's home. Workshops are offered where visitors can create their own wall painting of a bird under the guidance of the artist. The website contains a portfolio of completed wall paintings and references to publications where the artworks have appeared. | Painting → Murals 125 | wall paintings 18 bird 922 workshop 19325 | |
| studiobieb.nl | Studio Bieb | Studio Bieb offers a wide range of services, including family drawings, business coloring pages, children’s book illustrations, greeting cards, certificates and murals. The company began with Biebje, a figure known for her cheerful and colorful designs. Studio Bieb now focuses on diverse projects, such as brand identities for schools, birth announcements and products for children with special needs. The website offers a webshop, an account feature, a portfolio and a contact form, making it easy for customers to access the services and products of Studio Bieb. | | coloring pages 138 brand identity 1457 illustration 2447 portfolio 6854 design 27202 | |
| een10voordejuf.nl | Een Tien Voor De Juf | The website contains blog articles on topics such as sales skills, effective workshops, NEN 3140 VOP, online marketing, mediation, effective leadership, and document folders. Various types of training and workshops are offered, such as acquisition training, sales training, and leadership training. The website also provides information and tips on organizational tools, such as document folders, and promotional products, such as Spot UV printed business cards. | Education → Pedagogy & Methods 2944 | business card 270 folder 300 blog 13392 education 13471 workshop 19325 training 28133 | |
| plotgemak.nl | Plotgemak | The website provides a simple way to upload files and receive instant quotes for the plotting service. Customers can place orders for up to 3:30 PM on weekdays, after which they will be shipped the same day. Plotgemak.nl offers various paper types, scales, and finishes, and specifies the necessary delivery specifications, such as maximum file size. | Image Products → Photo Printing 54 Design & Creative → Graphic Services 1003 | blueprint 145 files 290 paper 770 poster 837 order 6912 quote 12863 | |
| alhetmoois.nl | Al het moois | The website sells artwork on 100% organic cotton pouches, tiles, and posters, specifically targeted at people interested in art, books, and interior design. The site offers gifts for various occasions, such as birthdays and anniversaries, with a focus on artwork. The website offers collaboration opportunities for retailers who want to expand their display. | Food → Gifts & Souvenirs 2421 | pouch 68 poster 837 tile 2869 art 3856 gift 6442 collaboration 16036 | |
| kuiperdonse.nl | KuiperDonse b.v. | The company, originally founded by Mrs. Kuiper in 1961 as Donse Verpakkingen, began as a foil printing workshop and later specialized in foil printing and embossing of cardboard and paper. After ceasing production of cardboard packaging over the years, KuiperDonse focused solely on foil printing and embossing of paper and cardboard. Through decades of experience and ongoing technological development, KuiperDonse has remained a specialist in this field, utilizing traditional methods. | Graphic Design → Cards 442 | foil printing 18 cardboard 170 paper 770 craftsmanship 1858 | Netherlands → Utrecht 48901 |
| vanburingen-art.nl | Pauline van Buringen | Pauline van Buringen is an artist specializing in graphic realism, a style that combines abstraction with high contrast and the use of light. The website displays a selection of her works, including paintings and linocuts, and shares information about her work in various locations, such as Hotel Spaander in Volendam. In addition to presenting her art, the website offers workshops focusing on linocut printing and painting. | Painting → Realism 200 | linocut 31 drawings 1329 paintings 3907 light 5148 workshop 19325 | Edam-Volendam → Edam 379 |
| harryvanderwoerd.nl | Harry van der Woerd | Harry van der Woerd attended drawing classes at the Rotterdam Art Academy as a teenager, which contributed to his later admission to the academy. Drawing is considered the foundation for all forms of art by Van der Woerd, both figurative and abstract. The website offers an overview of his oeuvre, including works in various styles such as landscapes, animals, nudes and religious themes, as well as information about exhibitions, workshops and publications. | | drawings 1329 paintings 3907 exhibition 5332 artist 5745 course 14728 | South-Holland → Rotterdam 25048 |
| grafiekdrukkerij.nl | De Grafiekdrukkerij | The website promotes various graphic courses and workshops, including the Summer Graphic Courses I and II, which take place in June and August, and a Christmas sale with artworks. Workshops are also offered, such as creating linoleum or woodcuts, and there are summer workshops available from July 31st to September 2nd. The website also contains an online shop with artworks by various artists, with a special Christmas sale offering discounts. | Visual Arts → Printmaking 302 Art & Culture → Art Events 327 | ij 17 graphic 74 art 3856 print 5511 course 14728 workshop 19325 | |
| marganiederervanhuizen.nl | Marga Niederer van Huizen | The website describes the artistic activities of Marga Niederer van Huizen, specifically her bookbinding work. Bookbinding lessons are offered, both small-scale individual lessons and larger workshops. The website also contains information about exhibitions, online sales, newsletters, social media profiles, and contact information. | Galleries → Online Galleries 225 | bookbinding 45 gallery 1983 publication 2018 lesson 5154 artist 5745 newsletter 6504 | |
| louisdegroot.nl | Louis de Groot | Louis de Groot was born in 1949 in Tilburg and obtained the MO Handvaardigheid diploma in 1975. His art focuses on capturing the essence of people and cultural heritage, often with a surrealist touch. He works in various techniques, including oil paint, pen drawing, charcoal, and watercolor, and frequently creates monumental works and challenges creativity. | Painting → Various Techniques 11 | oil painting 19 charcoal 138 watercolor 369 ceramics 1271 | |
| artstudiopotters.nl | Art Studio Potters | The artist offers workshops in September and October in Twente focusing on botanical painting, inspired by the local nature and the In de koperen ketel distillery. The studio sells hand-painted ceramics following the Ottoman tradition, including oil paintings and watercolors, including a series of flowers. The website contains contact information, newsletter signup, and general terms and conditions, as well as location information (Fanny Blankers-Koenstraat 6, Rijen) and KvK number. | Crafts → Ceramics 1156 | watercolor 369 ceramics 1271 paintings 3907 workshop 19325 | Gilze and Rijen → Rijen 493 |
| darkos-oneness.nl | Darko's Oneness | Darko Groenhagen is a Dutch tattoo artist specializing in Eastern and graphic tattoo styles, often of large format, such as Tibetan, Japanese, Indian, and Indonesian. He also works with comic, graffiti, and skull designs. The studio is relocating from Tilburg to Eindhoven and offers appointments in a private studio, creating a relaxed atmosphere and providing space for creative processes. The website informs about opening hours (Tuesday and Friday from 12:00 PM) and offers a newsletter for updates and developments. | | creative 539 tattoo 799 studio 5465 appointment 13510 | North-Brabant → Eindhoven 11845 |
| drukkunstbeurs.nl | Drukwerk in de Marge | The fair, organized by Drukwerk in de Marge, will be held on October 25th and 26th, 2025, at the Prodentfabriek in Amersfoort. Visitors can view and purchase a wide range of handmade printing, graphic books, special papers, and supplies for printers and artists. Workshops are also offered, and the fair is free to attend from 11:00 to 17:00 hours. | Business & Professional → Trade Shows 951 | demonstration 377 fair 583 paper 770 print 5511 workshop 19325 | Utrecht → Amersfoort 8011 |
| wilco-artbooks.nl | Wilco Art Books | The company offers a wide range of services, including project management, printing, binding, finishing, image processing and lithography. They work closely with various professionals in the art and culture sector, such as graphic designers, museums, artists, and galleries. The website presents portfolios of previous projects and provides contact information and general terms and conditions. | Design & Creative → Graphic Services 1003 | lithography 25 paper type 37 binding 70 project management 3423 print 5511 book 11396 | Utrecht → Amersfoort 8011 |
| isabelferrand.nl | Isabel Ferrand | The project ‘Plakkaat van Verbondenheid’ is a visual document of the history of Zeist, consisting of medallions that pay tribute to people, initiatives, and places connected to solidarity. Isabel Ferrand, a Portuguese and Dutch visual artist, lives and works in Zeist and finds her inspiration in local and personal stories. The website includes information about Isabel Ferrand’s life and work, her contact details, and copyright information, as well as links to her projects. | Visual Arts → Installation Art 576 | medallion 14 poster 837 artist 5745 | Utrecht → Zeist 2644 |
| teekensaandewand.nl | ‘Teekens aan de Wand Valkenburg’ Foundation | The website describes the history and characteristics of the murals in Valkenburg aan de Geul, which mostly date back to before 1930 and often exhibit influences of the Jugendstil style. The project documents more than 170 monuments in the Vestingstad Valkenburg aan de Geul, including the Hoogteburcht (tower), castles, churches, and city walls, particularly the wall advertisements. The foundation works together with the municipality, businesses and individuals to preserve these murals and has published a walking booklet with images of the frescoes. | Context 161394 | mural 338 foundation 6678 | Limburg → Valkenburg aan de Geul 1233 |
| lingewart.nl | Stichting LingeW'art | The foundation organizes various art manifestations and educational projects, including the Lingeprint Graphic Manifestation and art experiments. A key part of their work is organizing workshops and masterclasses around themes such as the Children’s Book Week and culture, often in collaboration with other organizations such as Clinck!. Stichting LingeW'art works with schools, municipalities and artists to organize creative activities and encourage the involvement of children and young people. | Art & Culture → Art Events 327 | manifestation 58 culture 3922 child 11566 education 13471 collaboration 16036 workshop 19325 | Lingewaard → Huissen 537 |
| dagvier.nl | Dagvier Lichtstudio | The studio focuses on creating visibility for valuable elements, utilizing various lighting effects. Visitors can subscribe to a newsletter to receive regular updates and inspiration. The website contains information about the team, projects, and the working methods of Dagvier Lichtstudio, located in Elburg. | | inspiration 4081 light 5148 newsletter 6504 | Gelderland → Elburg 846 |
| moetmoet.nl | MoetMoet Dutch Letterpress | MoetMoet is a small printing shop in Maastricht specializing in custom & handmade printing, executed with traditional techniques. Youri Penders, the owner, describes himself as an artisan storyteller, carefully translating his clients' stories onto paper. The website focuses on offering unique, tangible cards created with love and attention, with particular emphasis on birth announcements and wedding invitations. | Merchandise & Retail → Stationery 576 | letterpress 28 paper 770 craftsmanship 1858 card 1975 print 5511 story 8285 | |
| annettesieger.nl | Annette Sieger | The website includes a biography and a gallery of Annette Sieger’s works, categorized into different periods (work before 2000 and recent work). There is a section dedicated to Annette Sieger’s illustrations and graphic art. In addition to her artistic practice, the website describes Annette Sieger’s passion for cooking and gardening, with a focus on preparing meals for family and friends. | Artists → Dutch Artists 176 | graphics 123 cooking 801 drawings 1329 atelier 1417 paintings 3907 garden 13129 | |
| sharedstories.nl | Shared Stories Rights Agency | The company has been active since 2013 and represents publishers such as Alfabet, AnkhHermes, Atlas Contact, De Fontein, and many others. Shared Stories offers services related to translations, film rights, and stage rights. The office is located in Utrecht, Netherlands, and also has a location in New York. | Real Estate → Agencies 243 | copyright 255 agency 944 translation 1523 | North-Holland → Amsterdam 41253 |
| muldershouse.nl | Muldershouse Uitgeversmaatschappij | The website offers a broad selection of postcards on various themes, such as old cities in the Netherlands and abroad. Several series of postcards are available featuring works by renowned artists including Ando Hiroshige, Pierre-Joseph Redouté, Lawrence Alma-Tadema and A.E. Grolman. In addition to postcards, calendars, sympathy cards, skylines and special cards with flowers, insects and religious images are offered. | Photography → Photo 204 | postcard 278 calendar 1556 city 1875 artist 5745 | Edam-Volendam → Volendam 948 |
| ondinedekroon.nl | Ondine de Kroon | Ondine de Kroon is an artist specializing in linoleum cutting, considering it a form of artistic expression and storytelling. The ‘Peentje van de Binnenweg’ project is a community art project by Ondine de Kroon and Ana Glišić, commemorating the 80th liberation anniversary in Rotterdam, with more information available on the voordekunst website. The website features an online shop selling her artwork and providing information about workshops, shipping, and general terms and conditions. | Galleries → Online Galleries 225 | work 3122 portrait 3685 shop 6483 | South-Holland → The Hague 19898 |
| dichtbievandoan.nl | Dichtbie van Doan | The website presents poems by Daan van Vliet, which are known for their power and beauty of the Groning dialect. The poems are available in different formats, both loose versions and framed options, on hand-crafted paper. In addition to the poems, the website also offers tiles with excerpts from the poems, which can be used as decoration. | Visual Arts → Printmaking 302 | paper 770 frame 883 poem 1014 tile 2869 | Netherlands → Groningen 23734 |
| dianavanhal.nl | Diana van Hal | Diana van Hal was born in 1988 at the Willem de Koning Academy in Rotterdam and works with graphic techniques, specifically linocut. Her work is inspired by music, ethnic art, and travels to countries such as Ghana, Senegal, Cuba, and Mexico, where she combines human, animal, and botanical forms. Through the use of various materials and collaborations, she creates a sense of peace and harmony in her busy and colorful linocuts. | Visual Arts → Fine Art 322 | linocut 31 image 2605 color 4159 travel 7210 music 13170 | South-Holland → Rotterdam 25048 |
| anja-leerentveld.nl | Foto & Grafiek | The website offers macro photographs of water, etchings, and drawings, often based on photographs and etchings from the artist's own collection. Additionally, the site includes news updates about the artist's current projects and exhibitions. The website refers to an Instagram account to follow the latest developments. | Nature & Landscape → Macro Photography 14 | macrophotography 51 etchings 76 instagram 1216 drawings 1329 exhibition 5332 | |
| inekevanengelen.nl | Ineke van Engelen | The site offers various techniques such as graphic art, printing, rubbings, etching, and linocuts, as well as sketches and photography. Ineke van Engelen organizes workshops where visitors can create their own rubbings. The website contains a blog with quick sketches, both on paper and digitally, and portfolios of miniatures, analog, and digital drawings. | Painting → Individual Artists 668 | graphic art 89 miniatures 163 photographs 254 sketch 271 | |
| weerdruk.nl | Stichting Weerdruk | The foundation was established in 1996 by Martin Veltman and Wiek Molin. The website features various projects, including the colofon wereldboek, Eye Love Books, Familiereunie, Film, and Galerie Weerdruk. Contact information for St Weerdruk is available, including address and phone number. | Graphic Design & Printing → Typography 82 | printing technique 85 print 5511 foundation 6678 | North-Holland → Amsterdam 41253 |
| domienvanparys.nl | Domien van Parys | The website offers a gallery of Domien van Parys’s artwork, including pieces from the ‘Always remain yourself’ series, such as ‘Wasted Energy’. It details current and past projects, including the ‘Ver – dronken land — en er is hoop’ project, culminating in a finissage event on June 16th with a recitation of a poem. The website also announces the development of a new series of contemporary graphics and provides contact information for inquiries. | Graphic Design & Printing → Typography 82 | graphics 123 artwork 2248 | |
| beavanderheijden.nl | Bea van der Heijden | Bea van der Heijden is a visual artist working with paper and creating various artworks, including exhibitions, masks, and graphic series. Her work explores themes such as ‘Love, thirst, and death’, ‘In the Garden’, and the representation of ‘The Outside Place’ and ‘The Mothers’ School’. Bea van der Heijden has also created works around characters and symbols, such as ‘Athena’, ‘Eurydice’, ‘Ophelia’, ‘Danae’, and ‘Rose’. She has also worked on ‘Salamanders’ and ‘Ex Libris’. | Painting → Digital Art 820 | mask 381 character 449 artwork 2248 exhibition 5332 | |
| icon-art.nl | Icon Art | The website showcases a diverse collection of artwork, ranging from iconic celebrities and classical masterpieces to modern designs and styles such as Eric Kuster Metropolitan Luxury. Visitors can find artwork in various categories, including animals (lion, zebra, elephant, bird), celebrities (Marilyn Monroe), photography, and art styles. Icon Art offers attractive prices and free shipping in the Netherlands and Belgium, along with service options such as custom wall decor and Photoshop service. | Decor & Furnishings → Wall Decor 1035 | aluminum 1197 wall 1378 style 2348 collection 7566 photography 9503 | |
| interscreen.nl | Interscreen | Interscreen offers various advertising materials, such as car lettering, advertising boards, and plastic facade lettering. The website describes specializations in full-color printing and the printing of various materials using advanced techniques. Interscreen is located in Nijmegen and offers free advice and non-binding quotes, including no long-distance charges within a certain area. | Printing & Production → Printing 690 Clothing → Workwear 1001 | letter 834 advertising 2302 print 5511 | Gelderland → Nijmegen 9384 |
| devuurman.nl | De Vuurman | Pyrografie is an ancient craft dating back to the time before the discovery of fire, with early markings made using charcoal drawings on walls. The process involves burning patterns into wood using a brand pen connected to a transformer to precisely regulate temperature. Creating artwork requires skill and concentration. The website describes the possibilities of pyrografie, such as creating portraits of pets, landscapes, and household items, specifically coasters and nameplates, and explains the workflow for creating custom wooden artworks. | Decorative Arts & Crafts → Woodworking 10 | artwork 2248 portrait 3685 wood 4153 | |
| escher2023.nl | City of The Hague | The website offers information about various exhibitions of works inspired by Escher’s art, including ‘The Unknown Escher,’ ‘Tiles of Escher,’ and events such as the ‘Escher Week.’ In addition, other cultural events in The Hague are linked, such as concerts, lectures, and exhibitions of artists like New European Ensemble and Henri Jacobs. The site presents a calendar with dates, locations and locations where Escher-related activities take place, such as events in museums, buildings and public spaces. | Vacations → City Breaks 536 | calendar 1556 museum 2002 exhibition 5332 event 45199 | The Hague → City Center 445 |
| cecilebank.nl | Cecile Bank | Cecile Bank creates artwork in graphic art, drawings, and paintings, primarily using mixed techniques on canvas and paper. Her art focuses on nature, urban environments, and the continuous movement of life, utilizing fragments of photos, etchings, and drawings to create spatial compositions. The website includes an online shop where artwork can be purchased, a blog, information about exhibitions and a contact form for sending art cards and approaching the artist. | Painting → Acrylic Painting 547 | graphic art 89 online shop 1310 drawings 1329 paintings 3907 exhibition 5332 blog 13392 | |
| coppensalberts.nl | Coppens Alberts Studio | The studio has undertaken exhibition design work for the "Into the Black Hole" exhibition at the Radboud University / Valkhof Museum (2022-2023). They have created webshop designs, editorial book designs, and graphic identities for various projects and institutions such as Habitat, Piet Paris, and The Andy Warhol Collection. The studio’s work includes billboard design and stamp sheet editorial design, showcased in relation to the 100 jaar Nederlands Openluchtmuseum. | Architecture & Design → Creative Industries 1157 Galleries & Exhibitions → Exhibitions 1083 | book design 68 product design 94 webdesign 4092 | Nijmegen → Nijmegen-Center 92 |
| rafaellawang.nl | Rafaella Wang | The website lists various design projects, such as business card design, wedding invitations, and event designs, with references to creative events like '36 Days of Type' and 'A Year of Growth'. It features a collection of artistic endeavors including murals, menus for ‘Razmataz Vermouth’ and ‘Razmataz Gin’, and references to collaborative projects with organizations like 'Pluk de Nacht' and 'Samsung'. The website also includes locations referenced in its projects, notably ‘Zwarte Markt voor Kennis’ (Black Market for Knowledge), ‘De Brakke Grond’, and the ‘White House’. | Sculpture → Visual Arts 4165 | invitation 204 mural 338 design 27202 event 45199 | |
| dircknab.nl | Galerie De Kapberg | Dirck Nab is an artist specializing in painting, drawing, and graphic art. The website provides information about an exhibition at Galerie De Kapberg in Egmond aan de Hoef, from August 22nd to September 22nd, 2025, featuring a duo exhibition with Dien Jorien Geertsma. It also details a museum exhibition 'In the Back of the Sea' at Museum Kranenburgh in Bergen (NH), which illustrates the history of artists in the Bergen region and their interpretations of the polder landscape. | Painting → Dutch Art 322 | graphics 123 polder 476 drawings 1329 museum 2002 paintings 3907 exhibition 5332 | Bergen → Egmond aan den Hoef 142 |
| peaceposters.nl | Peace Posters | Starting November 13th, 2024, new posters will be found in the streets of Amsterdam, Haarlem, Tilburg, Ghent and Nijmegen. The website offers photos of the posters and stories about the background of the texts, often inspired by philosophical concepts and religious traditions. An event is planned, a Peace Walk through Amsterdam-South, to view and share the posters. | Civic Engagement → Social Activism 73 | poster 837 story 8285 | North-Holland → Haarlem 8674 |
| paleeshahandcrafts.nl | Paleesha Handcrafts | The website offers a range of products including jewelry, hoodies, mugs, and bookmarks. It also provides specialized screen printing sets (VeroS Silkscreen) in various sizes and configurations. The website includes sections for events, custom requests, care instructions, and legal policies. | Clothing → Activewear 642 | bookmarks 30 hoodies 121 screen printing 128 mug 280 item 1125 jewelry 4599 | |
| truecolourstattoo.nl | True Colours Tattoo | The studio emphasizes the value of tattooing as a form of art, highlighting quality, hygiene, and an informative consultation process. True Colours Tattoo offers a wide range of tattoo styles, including realistic, color, black & grey, and mandala tattoos, as well as cover-ups. The site features the work of various tattoo artists, including Edgar Lamper, Artxymoron, InkTor, Pabon, Camilo Florez, and Pedro Gelvez Pepo, and includes client reviews. | Tattoo & Piercing → Tattoo Studios 202 | tattoo 799 art 3856 artist 5745 design 27202 | |
| fotomodernlochem.nl | Foto Modern Lochem | The company offers a wide range of services such as photo sales, photography, copying, printing, framing, and the creation of digital photo albums. In addition to traditional services, Foto Modern Lochem also offers copying, memorial printing, framing services, bookbinding and a graphic workshop. Visitors can send photos directly via WhatsApp, and the company offers various printing options, from envelopes and cards to flyers, calendars, and family printing. | Arts → Decorative Arts & Crafts 825 | letterpress 28 frame 883 print 5511 photography 9503 | Gelderland → Lochem 1587 |
| lichtletterverhuurgroningen.nl | Lichtletterverhuur Groningen | The website offers a wide variety of illuminated letters in all letters of the alphabet, numbers, and symbols, which are over 1 meter tall and weather-resistant. Customers can rent letters for different purposes, such as decorating weddings, parties, festivals, and corporate events, highlighting the dimmable lighting feature. The rental company also offers delivery and connection services, allowing customers to focus on organizing their event. | Language Learning → Language 1689 | alphabet 27 letter 834 decoration 4085 wedding 4258 party 5928 event 45199 | |
| studiomeems.nl | Studio MEEMS | The website provides hand-drawn illustrations and freelance communication, design, and DTP services, with a focus on illustrations for pregnancies. A description of the ‘Sunprint Calendar’ is presented, featuring images created using cyanotype, made from collected natural materials, to record important events. A ‘Year Planner 2025’ is offered to create an overview of family schedules and appointments, available individually or in packages. | Services → Personal Services 1062 | line 236 planner 237 calendar 1556 illustration 2447 logo 4660 communication 10162 | |
| atelier-de-garage.nl | Louise de Vries Lentsch | The website features a diverse portfolio of Louise de Vries Lentsch’s artwork, ranging from graphic art to photography and bookbinding. A book with and about her artwork has been published and can be ordered through the website. The website contains information about her studio, the location in Amersfoort, and opening hours by appointment. | Painting → Individual Artists 668 | artwork 2248 studio 5465 book 11396 | Utrecht → Amersfoort 8011 |
| stichtingnobilis.nl | Stichting Nobilis | The center showcases print art and engravings, including the double exhibition 'Print Art from Ukraine' and mezzotints by Gerda Förster. The website offers information about Nobilis’s collections, including regional collections, atelier legacies and the donation from the Dumon family with a collection of small print art. Nobilis offers various activities such as workshops for adults and children, and the opportunity to become a friend, volunteer, or donor. | Visual Arts → Museums 2049 | exhibition 5332 artist 5745 collection 7566 workshop 19325 | Ooststellingwerf → Fochteloo 14 |
| pimtieland.nl | Club Solo | The website highlights several exhibitions featuring Tieland's work, including 'Lovers in Debate' and 'An Architecture of Encounters,' alongside collaborative projects with other artists. Exhibitions presented include ‘Grafiek & De Jonge Kunstenaar’ at Willem Twee / Grafisch Atelier in Den Bosch, and ‘Let us meet and let us meet again’ at Casco Art Institute in Utrecht. Tieland’s work spans various mediums, including paintings such as ‘The Lover’s Body,’ and sculptural pieces like ‘The Associates Lobby,’ displayed in venues across the Netherlands, such as NP3 in Groningen. | Painting → Contemporary Art 805 | sculpture 1440 exhibition 5332 artist 5745 paint 8747 collaboration 16036 | North-Brabant → 's-Hertogenbosch 8868 |
| ludodekort.nl | Ludo de Kort | Ludo de Kort, born in Turnhout in 1966, is an artist who engages with the relationship between modern humanity and the natural world. His work encompasses a wide range of projects, including graphic art, photography, and installations, often experimental and technologically driven. The website provides an overview of his projects, exhibitions, and publications, and includes information about recent and historical works. | Artists & Studios → Galleries 1398 | graphic art 89 technique 2157 exhibition 5332 artist 5745 photography 9503 | |
| stencilwerck.nl | Stencilwerck Riso print room & publishing | Stencilwerck specializes in working with artists and offering Riso print services. The website showcases a selection of published works, including books, zines, and wallpapers. Riso print workshops are offered, and there's a display of artwork by various artists such as Rik Buter and Melle de Boer. | Books → Publishers 1040 | zine 29 wallpaper 1756 artist 5745 book 11396 workshop 19325 | South-Holland → The Hague 19898 |
| friedolien.nl | Friedolien | The webshop offers a selection of maps and prints with handmade illustrations. The illustrations are drawn and painted using various materials, including gouache, pencils, and fineliners, and often include a funny, cute, or cozy detail. The website provides services such as shipping, payment, returns, and a newsletter. | | maps 331 illustration 2447 animal 2908 print 5511 newsletter 6504 nature 9094 | |
| kokonoma.nl | Kokonoma Graphic Design | Darja Brouwers offers her expertise in graphic design, including concept development, design, and illustration. The website describes a collaborative approach to the design process, with reliable partners (web and app builders, copywriters, printers, and other specialists) at the core. Kokonoma Graphic Design is located in Utrecht, Netherlands, and offers services related to graphic design, illustration and hand lettering. | Architecture & Design → Creative Industries 1157 | handlettering 45 graphic design 2042 illustration 2447 concept 3338 design 27202 | Friesland → Vlieland 518 |
| wuyts-degroot.nl | Josée Wuyts and Frans de Groot | Josée Wuyts and Frans de Groot are graphic artists who have been working in Nijmegen since 1990 on various graphic projects, including GRAFIEKUITGAVE DE VAL, HET KUNSTENAARSBOEK ADELAARSVAART, and the series AAN DE RAND EN HUIS. Their work focuses on the human figure in relation to abstract typographic forms, utilizing diverse printing techniques such as etching, aquatint, and woodcut. The website provides an overview of their exhibitions, membership of the graphic platform, and their Toorop friendship with Grafein, and links to other relevant websites. | Visual Arts → Printmaking 302 | printing technique 85 graphic art 89 paintings 3907 exhibition 5332 artist 5745 | Gelderland → Nijmegen 9384 |
| liastouten.nl | Lia Stouten | The website describes the characteristics of Lia Stouten’s work, with an emphasis on the combination of language and imagery, simplicity and minimalism, as well as rhythm and repetition. Lia Stouten offers an overview of her diverse oeuvre, including prints, books, installations, print biennials, and dotted figures. The website also contains information about her career, such as a CV, publications, a blog, exhibitions, and interesting links, as well as a newsletter and guestbook. | Resources → Books 3936 | symbol 149 imagery 200 paper 770 print 5511 book 11396 installation 13742 | |
| henrypennings.nl | Henry Pennings | The website provides extensive information about Henry Pennings' photography and linocuts. Visitors can easily purchase artworks by Henry Pennings here. The copyright of the displayed works belongs to the respective artists, and use of the images requires written permission. | Artistic Expression → Fine Art Photography 502 | linocut 31 copyright 255 address 901 artwork 2248 shop 6483 photography 9503 | |
| marleenstoelwinder.nl | Marleen Stoelwinder Graphic and Illustrative Design | Marleen Stoelwinder is a versatile artist and designer known for her groundbreaking collages and graphic designs. She offers services for the design of various visual communications, including business cards, birth announcements, exhibitions, and graphic materials. Marleen creates unique collages and graphic elements and is a concept developer for diverse projects and exhibitions. | Arts → Imaging & Photography 7687 | visual communication 115 concept development 143 collage 262 design 27202 | |
| kjellweewer.nl | Kjell Weewer | The website offers an overview of Kjell Weewer’s artwork, including portraits, etchings, landscapes, photography, and installations. The artist describes his artistic research into the relationship between humans and their environment through painting, drawing, intaglio and relief printing, as well as photography and installations. The website also provides links to relevant websites and a newsletter. | | etchings 76 landscape 2609 portrait 3685 paint 8747 photography 9503 installation 13742 | Rheden → Velp 700 |
| johanvandam.nl | Johan van Dam | Since 1992, Johan van Dam has worked as a caricature artist at various events. He offers his services for corporate events, weddings, trade fairs, and street markets, allowing guests to watch the creation of a caricature in real-time. Different options are available, including standard, super-fast, and digital caricatures with varying prices and execution methods. | Artists & Studios → Creative Professionals 19 | easel 11 caricature 72 drawings 1329 event 45199 | |
| intermedi-art.nl | Intermedi-Art Kunstzaken | Intermedi-Art commissioned Dutch artists annually from 1994 to 2018 to create graphic works inspired by Nijmegen. City prints of Nijmegen, Arnhem, and Zutphen have been issued by Intermedi-Art. The website includes a news section featuring cultural activities and a contact form for inquiries about the city prints. | Collections & Antiques → Collections 177 Art & Culture → Art Events 327 | graphic art 89 artist 5745 | Gelderland → Zutphen 2690 |
| keesstoop.nl | Kees Stoop Stichting | The website contains an overview of various types of drawings by Kees Stoop, such as abstract works, etchings, dry needle drawings, and other works. Information is provided about exhibitions he has organized and a film impression of a documentary about his work ("The late years"). The website offers details about his book 'Kees Stoop, Life and Work', including where it can be purchased and a link to the works found in the Rijksprentenkabinet in Amsterdam. | Galleries & Exhibitions → Exhibitions 1083 | drawings 1329 exhibition 5332 studio 5465 book 11396 | North-Holland → Amsterdam 41253 |
| grafiek2022.nl | Stichting Grafein | The fourth Grafiek2022 triennial takes place from September 1st to November 30th and focuses on the theme ‘Meeting’ with exhibitions, workshops and lectures. Stichting Grafein facilitates the triennial by providing a platform and coordinating the PR campaign, while the participating locations organize their own events. Grafiek25, the next graphic triennial, is planned for 2025 and will be found under the domain grafiek25.nl. | Art & Culture → Art Events 327 | graphic 74 lecture 1624 exhibition 5332 artist 5745 workshop 19325 | Southwest-Friesland → Oosthem 14 |
| ibnokhaldoun.nl | ibnokhaldoun.nl | The website offers ideas for stylish outdoor decoration for balconies and gardens, aiming to extend the living room space. Articles address the importance of SEO and building a noticeable online brand identity. Reviews of restaurants in Scheidam and descriptions of various Japanese dishes, including Tantanmen Beef Ramen, as well as the benefits of vaping and cannabis for seniors are presented. | Architecture & Design → Creative Industries 1157 | ramen 106 decor 945 brand identity 1457 animation 1777 marketing 7107 restaurant 11215 | |
| marjokeschulten.nl | Marjoke Schulten | Marjoke Schulten is a visual artist who visualizes her travels in colorful graphic art and small objects. Her work is inspired by various travel forms, such as zeppelin, submarine and rocket, and is often based on elements she used during her work with futuristic themes. The website describes a collective of Rotterdamse female artists and provides information about her artwork, including the possibility of purchase, rental and viewing her portfolio. | Painting → Individual Artists 668 | graphic art 89 collective 256 adventure 919 artwork 2248 portfolio 6854 | Rotterdam → Center 382 |
| kunstvandoorenmaalen.nl | Marjolein van Doorenmaalen | Marjolein van Doorenmaalen (born in 1962) has been working as an artist since 1990. Her work includes oil paintings, watercolors, graphic art, and objects crafted from diverse materials. The website is organized into categories based on subject and technique, with an emphasis on nature, houses, and trees. | Painting → Oil Painting 326 Painting → Watercolor 274 | graphic art 89 watercolor 369 objects 426 tree 1879 paintings 3907 house 8121 | |
| benee-awraham.nl | Messiasbelijdende Gemeente Benee Awraham | The congregation holds regular gatherings on Saturdays and during Biblical Feasts. The website offers a schedule with speaker information for upcoming gatherings in Baarn. The congregation offers studies, lectures and archives which can be visited. | Christianity → Protestant Traditions 152 | saturday 39 invitation 204 gathering 394 study 720 | Utrecht → Baarn 1628 |
| basementpress.nl | Stichting BPD | The workshop provides professional lithographers and guidance to visual artists, fine art students, and students from primary and secondary education, to help them learn and develop the lithography technique. BPD is equipped as the best-equipped stone printing workshop in the Benelux and features a museum-quality platen press from 1842 and an etching press for creating etchings and plate lithographs. In addition to printing lithographs and woodcuts, BPD is also a publisher of graphic art prints by various artists and is developing into an international knowledge center for lithography. | Books → Publishers 1040 | lithography 25 printing press 52 publisher 757 artist 5745 course 14728 workshop 19325 | Hof van Twente → Diepenheim 200 |
| grafischatelierminnigh.nl | Grafisch Atelier Minnigh | The studio offers a creative center and a productive workspace for artists. It organizes a variety of events, such as open studios, print swaps, and courses, to encourage collaboration. Membership provides access to the workshop 24/7 and the opportunity to print independently, with guidance available as needed. | Visual Arts → Printmaking 302 Painting → Contemporary Art 805 | printmaking 40 studio 5465 artist 5745 membership 10442 course 14728 event 45199 | South-Holland → Rotterdam 25048 |
| cees-elzinga.nl | Cees Elzinga | Cees Elzinga creates woodcuts in his studio, utilizing a drawing table, space to gouge, a wide cabinet for paper, and a smaller cabinet with many drawers for storing his prints. He describes his studio as not very large but would like more space to store more items. He enjoys working in his studio and listens to classical music while doing so. The website provides information about exhibitions, the material (paper), contact details, and a possibility to purchase artwork. | Woodworking → Wood Carving 139 Crafts & Hobbies → Craftsmen 52 | woodcut 45 paper 770 exhibition 5332 studio 5465 music 13170 | |
| grafischateliermaarssen.nl | Grafisch Atelier Maarssen | The website describes the activities of the atelier, including beginner workshops on techniques such as relief printing, intaglio printing, and etching. The atelier, which has been active since 1978, is open to members and provides space for the creation and sharing of graphic art. The atelier shares its passion for graphic art with the public by regularly organizing exhibitions in Maarssen and the surrounding area. | Visual Arts → Printmaking 302 | printmaking 40 atelier 1417 technique 2157 exhibition 5332 artist 5745 workshop 19325 | Stichtse Vecht → Maarssen 1051 |
| xram44.nl | Max Marx | The website details Max Marx's childhood in Sittard, where he and other children used ‘leem’ (clay) from a ‘leem koel’ (clay cooling station) on the Kollenberg hill to create various objects. The website provides an overview of his artworks, including paintings, linoleum prints, drawings, and pastels, alongside an online shop selling jewelry and a service to send art cards. The pages describe his artistic journey, beginning with his interest in painting after a workshop in Sittard and his studies at the Maastricht City Academy, where he received the ‘Lucas’ art prize in 1965. | Visual Arts → Printmaking 302 Artists → Studios 152 | art card 102 drawings 1329 gallery 1983 paintings 3907 artist 5745 | Sittard-Geleen → Sittard 1997 |
| elslemkes.nl | Els Lemkes | The website utilizes cookies and Javascript to optimize functionality and directs users to privacy policies. Els Lemkes uses hand-woven antique linen, sourced from her mother-in-law who was a farmer in the Achterhoek region, as the basis for her graphic art. The website describes the historical value of farmer’s linen and the effort to preserve this tradition. | Artists → Dutch Artists 176 | linen 194 biography 697 tradition 736 artwork 2248 studio 5465 | Nijkerk → Achterhoek 1730 |
| miekekettler.nl | Mieke Kettler | Mieke Kettler is an etcher who developed her techniques at the Graphic Workshop in The Hague, starting with engraving and later expanding to etching with aluminum foil. Her work is characterized by geometric shapes and transparent prints, often using ‘drypoint’ etching techniques. Her work is included in collections of government agencies, private collectors, and is exhibited in various exhibitions, both in the Netherlands and abroad. She has been recognized as an artist for 38 years through Stroom and is a member of the BBK. | Personal → Biographical 44 | etching 48 exhibition 5332 collection 7566 | Katwijk → Katwijk-North 24 |
| janderuijter.nl | Jan de Ruijter | Jan de Ruijter was born in 1954 in Leidschendam and has developed a fascination for lino and woodcuts. His work is often based on nature, particularly landscapes, flowers, and birds such as crows and ravens. The techniques used include colored woodcuts, relief printing, and reductive printing, with multiple printing passes and colors to create a specific atmosphere. | | woodcut 45 landscape 2609 color 4159 nature 9094 | |
| grafischewerkplaatsnijmegen.nl | Stichting Grafische Werkplaats Nijmegen | The website provides information about various courses and workshops, including Introduction to Graphic Arts, Etching, Toyobo etching, and screen printing. The Participation Scheme allows for reimbursement of up to €150 for courses or activities at the workshop, often for a cost of €75. The website presents job postings for graphic artists and provides information about the foundation that runs the workshop. | Visual Arts → Printmaking 302 Painting → Contemporary Painting 452 | etching 48 graphic art 89 course 14728 workshop 19325 | Gelderland → Nijmegen 9384 |
| rosemarijnvanlimburgstirum.nl | Rosemarijn van Limburg Stirum | Rosemarijn van Limburg Stirum creates graphic work, such as prints and ex libris, and paints using various techniques, including pastels and thin layers, often with vibrant colors and strong forms. She offers her work for sale and on commission, and has an online portfolio featuring a selection of her paintings. Her books are visual and combined with text in lead. The website contains a blog with recent news and exhibition information, as well as the location and opening hours of her studio in Eindhoven. | Visual Arts → Printmaking 302 | graphic work 21 paintings 3907 studio 5465 portfolio 6854 event 45199 | North-Brabant → Eindhoven 11845 |
| drukdruk-emmen.nl | Educatief Creatief Atelier DrukDruk | The studio offers workshops in diverse printing techniques, including dry etching, cardboard printing, linoleum printing, material printing, screen printing, and textile or paper screen printing. In addition to the workshops, courses are offered, such as a course about Picasso and Toyisme. The studio also offers workshops on location for schools and companies. | | printing technique 85 studio 5465 course 14728 workshop 19325 design 27202 | Drenthe → Emmen 3348 |
| lienvanhoren.nl | Lien van Horen | The website offers stories under the names ‘Papierpraat’ and ‘Koekoek en Fries’. The stories cover the daily life and interactions of people in various situations. The website is owned by Lien van Horen and is based on a WordPress platform. | Freelancers → Writers 609 Fiction → Short Stories 311 | paper 770 texts 1218 wordpress 3551 story 8285 | |
| ursulasteenaart.nl | Ursula Steenaart | Ursula Steenaart is a graphic artist who makes screen prints and linocuts. She completed her initial training in graphic arts at the Academy of Visual Arts and began using these techniques in 2013. Steenaart often uses objects from her surroundings as inspiration and employs contrasting colors to emphasize details. | Sculpture → Visual Arts 4165 | linocut 31 screenprint 42 graphic art 89 studio 5465 | |
| papiergeschiedenistwente.nl | Papiergeschiedenis Twente | Twente was known in the 18th century for successfully producing paper, utilizing watermills and streams to create high-quality white paper that was award-winning. The website describes the paper mills in various Twente locations, such as Mander, Hezingen/Nutter, Oud Ootmarsum, Geesteren, Oldenzaal, and Deurningen, and offers accompanying photos. The origin of the Berghuizer Paper Factory, later owned by B. Cramer, is also explained. Museumwerkplaats de Akker in Hengelo, founded by graphic designer Willie Bosch, offers a collection of historical decorative papers, watermarks, materials, and tools from old printing shops and bookbinders. Part of this collection is accessible via the website. | Marketing & Branding → Paper 93 | paper 770 | Tubbergen → Mander 25 |
| pimvijftigschild.nl | Pim Vijftigschild | Pim Vijftigschild is a visual artist who works with different techniques, including graphic art, oil painting, illustration, and photography. The portfolio includes work in the categories Photography, Graphic Art, Publications, and Oil Painting. Specific subjects in his work include Dinky toys, portraits, landscapes, and animals. | Visual Arts → Printmaking 302 | oil painting 19 visual artist 42 woodcut 45 graphic art 89 publication 2018 photography 9503 | |
| skizze.nl | Skizze | The residency offers an inspiring environment for designers, writers, and other creatives, focusing on print, typography, form, color, and ideas. Guests can gain practical experience with paper and printmaking, exploring their creativity. The residency also organizes newsletters and has a presence on social media platforms like Instagram and LinkedIn. | Architecture & Design → Creative Industries 1157 | printmaking 40 residency 100 paper 770 workshop 19325 design 27202 | Tubbergen → Harbrinkhoek 48 |
| joophekman.nl | Joop Hekman | Joop Hekman began his career in 1938 at the Academie Kunstoefening in Arnhem, under the guidance of Gijs Jacobs van den Hoff and Wienecke, who discovered his talent and taught him how to make coins and medals. His oeuvre includes various art forms, such as sculptures, sculpture groups, relief sculptures, reliefs, mosaics, and monumental works, often with an architectural context that he designs himself. Hekman is also known for his designs for medals and coins, as well as his expertise in creating watermarks for banknotes. His works can be found in various locations, such as Utrecht, Doorn, and Enschede. | Visual Arts → Sculptors 203 | fountain 96 medal 213 bronze 225 academy 593 sculpture 1440 | Woerden → Harmelen 335 |
| corienbogels.nl | Corien Bögels | Corien Bögels offers a range of services, including business drawing, dialogue boards (praatplaten), visual trajectory guidance, and illustrations. She produces such things as logos, brand styles (huisstijl), book illustrations, infographics, technical illustrations, and jubilee portraits. Bögels also provides visual trajectory guidance, working to visualize concepts, support subsidy applications, design brand styles and clarify processes and roles within organizations. | | brand style 276 drawings 1329 illustration 2447 logo 4660 | |
| frisius.nl | FRISIUS | The website sells reproductions of historical maps in various materials such as poster paper, photo wallpaper, aluminum, and canvas. It features an extensive collection, including city plans, province maps, military maps and expansion plans. Visitors can choose their own map size and select from various materials to suit their interior. | Decor & Furnishings → Wall Decor 1035 | reproduction 60 wall decor 213 maps 331 interior 8093 | |
| tattooletters.nl | Tattooletters.nl | Users can compare various fonts online and download their desired text to show to a professional tattoo artist. The website offers inspiration for different fonts, such as bold block letters or ornate fonts with loops and shapes, and warns about readability with longer texts. The website contains tips on choosing the right font size, depending on the placement of the tattoo, and emphasizes the importance of a readable text. | Art Forms → Tattoos 381 | font 71 tattoo 799 text 2467 design 27202 | |
| nutkrimpen.nl | NUT Krimpen | The website presents the program for the 2025-2026 season, with a diverse range of courses and lectures. Last season, the language courses were discontinued due to a lack of participants, but the exhibition of painting groups was a success. The NUT Krimpen is the only course department within the national branch and has a long tradition, with former chairwoman Carla Campen writing her foreword in 2006 about the existing course departments in the Netherlands. | Games & Play → Games 3911 | department 269 nuts 417 lecture 1624 course 14728 | |
| ariezonneveld.nl | AELZET | The website contains information about Arie Zonneveld, including his biography, life story, exhibitions, and works, such as woodcuts and watercolors. There is a catalog of his artworks, as well as information about similar artists, such as William Seltzer Rice, Gustave Baumann, and Pedro de Lemos. The site documents the genealogy of the Zonneveld family and includes information about members such as Piet Zonneveld and Annie Zonneveld Simonis. | Biographies & Figures → Biographical Data 17 Social Sciences → Genealogy & Family History 1403 | woodcut 45 statistics 392 catalog 812 exhibition 5332 artist 5745 family 6462 | |
| siebetekent.nl | SiebeTekent.nl | The book describes the journey of Sieltje, a young seal with a bullhead, and their adventures, including rescuing a seal from orcas and meeting Neptune. The picture book is inspired by the bullhead Jojo who swam off the coast of South Holland in 2018 and the seals that are increasingly seen at the Scheveningen harbor heads. A portion of the proceeds goes to Stichting De Noordzee (The Northern Sea Foundation), and purchasing the book contributes to the sustainable use and protection of the North Sea. | Children’s Books → Picture Books 90 | north sea 87 seal 264 journey 701 illustration 2447 foundation 6678 book 11396 | South-Holland → Rotterdam 25048 |
| airbrushbeerepoot.nl | Airbrush Beerepoot | The website provides an up-to-date overview of Mark Beerepoot’s recent projects, a graffiti and airbrush artist. Visitors can follow his work on social media for extra inspiration and a peek behind the scenes. The website also contains a portfolio showcasing a diverse range of creations, from realistic projects to abstract art and murals. | Websites → Portfolio Pages 15 | airbrush 52 canvas 694 artwork 2248 social media 3342 portfolio 6854 | |
| jannekehoek.nl | Janneke Hoek | Janneke Hoek is an illustrator and visual artist proficient in various art forms, including illustrations, linocuts, woodcuts, screen printing, etching, and silkscreen printing. One of her works, 'The Tree Afraid of a Field Sparrow,' is an illustration accompanying a story by Kees van der Zwaard, created using paper, ecoline, chalk, and pencil. She has worked on posters for various institutions, including The Canal, The New Church, The String Beans, and Op het Spel. She also publishes her comic strip 'Gewoon Henk'. | | linocut 31 woodcut 45 comic 59 watercolor 369 poster 837 illustration 2447 | Netherlands → Groningen 23734 |
| letterkunst.nl | Letterkunst | The website features various galleries displaying examples of her work, including collages, hand lettering, posters, books, traditional and free calligraphy commissions, wall paintings, mandalas, boxes, Christmas cards, and ceramics. Visitors can learn more about Wilma van der Leer herself, her background and inspiration, as well as her courses and where her work can be seen. In addition to the visual presentation of her work, the website provides contact information, including an email address and phone number, and a guestbook for interaction with visitors. | Painting → Digital Art 820 | calligraphy 69 collage 262 gallery 1983 artwork 2248 course 14728 | |
| lijstkado.nl | Lijst & Kado | The website provides information about the framing service, where glass and mats are cut and stretched directly. Lijst & Kado offers services such as framing posters, photos, watercolors, birth certificates, fabrics, batiks, embroidery, clothing, and diplomas. The website describes the collection of wall decorations in the store and offers custom art from a catalog, as well as picture frames. | Food → Gifts & Souvenirs 2421 | wall decor 213 greeting card 335 frame 883 frames 2556 gift 6442 | South-Holland → Leiden 7089 |
| drawingsbydesi.nl | DrawingsbyDesi | Desi Berghuis is an artist who, after studying graphic design, now draws again, primarily focusing on animals. She offers custom drawings, including portraits of pets, and encourages visitors to contact her for further possibilities. A drawing of an animal, such as a pastel drawing of a pet, is an original and personal gift idea. | Painting → Pastel Painting 17 | pastel 99 email 1012 drawings 1329 pet 1617 animal 2908 portrait 3685 | |
| gspkatwijk.nl | GSP Katwijk | The company originated from Drukkerij De Zuid and Station Drukwerk in 't Heen, and has been operating as GSP Katwijk in the center of Katwijk since 2011. GSP Katwijk provides services such as design, layout, printing, signmaking, and the production of magazines, catalogs, posters, and advertising materials. Gerrit Schaap, the owner, has extensive experience in the printing industry, beginning with his father and expanding through various partnerships. | Design → Graphic Design 2433 | layout 899 magazine 2182 print 5511 design 27202 | South-Holland → Katwijk 2183 |
| janbraber.nl | Jan Braber | The website introduces Jan Braber as an artist specializing in paintings and sculptures. He describes his artistic process as observing and analyzing reality, with a focus on experimenting with techniques and materials. Braber’s work is available for purchase as well as rent, with a rental fee of 3% of the purchase price. This promotes saving for future art purchases. The website outlines Braber’s work area, ranging from art and design to designing buildings, and mentions recent projects such as exhibitions and commissioned work at Interieur Paauwe and Kiremko. | Painting → Acrylic Painting 547 | sculpture 1440 paintings 3907 exhibition 5332 music 13170 design 27202 | Utrecht → Montfoort 673 |
| yldaureitsma.nl | Yldau Reitsma | The website features a shop selling art and home decor, including graphic art and printwork created by Yldau Reitsma. In addition to her own products, items are also offered from local entrepreneurs, each with a unique story. Yldau Reitsma also provides services as a Multimedia Expert and Graphic Designer, including logo design, branding, and digital marketing. | Artists & Studios → Galleries 1398 Home → Antiques & Collectibles 1523 | decor 945 art 3856 sustainability 18451 design 27202 | Southwest-Friesland → Workum 363 |
| graffa.nl | Graffa Gallery | The gallery showcases graphic art and drawings from artists such as Annette Fienieg, Frank Dekkers, and Han van Hagen. Visitors can purchase artwork with free shipping in the Netherlands. The website provides information about the artists and their work, categorized by artist and technique. | Home → Antiques & Collectibles 1523 | graphic art 89 drawings 1329 technique 2157 print 5511 artist 5745 | South-Holland → Rotterdam 25048 |
| timblaauw.nl | Tim Blaauw | Tim Blaauw’s work primarily focuses on the railway in all its variations, from old to new, and its relationship with the surroundings. In addition to railway-related work, the website also offers maps, shells, and other landscapes. Blaauw’s art emphasizes untouched nature and the impact of humans on the landscape, using woodcuts and drawings to capture this. | Visual Arts → Drawing 1046 | woodcut 45 railway 105 drawings 1329 landscape 2609 | |
| dewit-tattoo.nl | De Wit Tattoo & Design | The website describes the services of De Wit Tattoo & Design, with a specialization in fineline, lettering and realistic black & grey tattoos. A portfolio is available to showcase the studio's work, both in the field of tattooing and graphic design. The website lists opening hours, address and contact information, as well as general terms and conditions and privacy policy. | Art Forms → Tattoos 381 | tattoo 799 brand identity 1457 idea 2367 portfolio 6854 appointment 13510 design 27202 | South-Holland → Delft 5309 |
| jennypiso.nl | Jenny Piso | Jenny Piso lives and works in Leeuwarden, where she also has her studio and offers various workshops, including graphic art workshops and eco-art workshops. The website showcases a portfolio of her work, including drawings, mixed media, graphic art, paintings, reliefs, photography, and installation art. The website contains an overview of recent and upcoming exhibitions where Jenny Piso presents her work, often in collaboration with other artists or collectives. | Sculpture → Visual Arts 4165 | graphic art 89 exhibition 5332 studio 5465 artist 5745 portfolio 6854 workshop 19325 | Southwest-Friesland → Bolsward 566 |
| dickheins.nl | Studio Dick Heins | The website describes the services offered by Studio Dick Heins, including caricatures, comic strips, cartoons, illustrations, Jan van Haasteren puzzles, and ink and coloring work. The studio also offers drawing workshops and has a blog with recent updates. The website includes information about recent projects, such as completing a page of ‘Billy, Man of the World,’ and creating Jan van Haasteren puzzles. | Children’s Books → Comic Books 96 | comic strip 13 caricature 72 cartoon 160 puzzle 811 illustration 2447 workshop 19325 | North-Brabant → Oosterhout 2086 |
| jkvisuals.nl | JK Visuals | The website describes JK Visuals as a company focused on 2D & 3D (graphic) design and visualization, ranging from logos to complete residential developments. JK Visuals offers services such as graphic design and image editing, including branding, brochures, and websites. The website contains contact information and a location in Megen, emphasizing the ability to concretize ideas and convince others. | Architecture → Visualization 180 | residential development 37 visualization 621 idea 2367 branding 4614 logo 4660 | Oss → Megen 82 |
| faberreklame.nl | Faber Reklame | The website offers a diverse assortment of products, including flags, banners, signage, promotional items, textiles, and wayfinding systems. Faber Reklame specializes in creative and eye-catching advertising solutions, ranging from vehicle lettering to building signage and digital displays. The website highlights Faber Reklame's expertise in creating impactful results by combining customer wishes with craftsmanship and creativity. | Advertising → Vehicle Advertising 55 Advertising → Advertising Materials 292 | wayfinding 48 promotional items 251 banner 518 signage 838 advertising 2302 design 27202 | |
| matrixdesign.nl | Matrix Design | The website provides a wide range of services for both vehicles and buildings, from outdoor advertising such as billboards and facade signage to interior decoration such as window film and wall decoration. Matrix Design specializes in various types of advertising, including fleet marking, car wrapping, tinted windows and full sun-blocking film. The company also offers services for construction signs, real estate signs and sponsorship signs, and emphasizes its leading position in the sign-making industry through the diverse solutions it provides, with an eye for detail and customer advice. | Decor & Furnishings → Wall Decor 1035 | billboard 44 advertising 2302 film 3007 car 10865 design 27202 | |
| binderij-amsterdam.nl | Binderij Amsterdam Grafische Afwerking | The bindery offers a wide range of graphic finishing services, including binding, folding, and shipping of books, magazines, and journals. They specialize in threadless stitching and provide solutions for various materials. The website provides information about the history of the bookbindery, supply tips, and the possibility to request a quote online. | Marketing → Direct Mail & Distribution 286 Design & Creative → Graphic Services 1003 | graphic finishing 10 bookbinding 45 quote 12863 | |
| marwinkarikatuur.nl | Marwin Saris | The website presents examples of caricatures that can be printed on various products, such as canvases, t-shirts, and invitations. The site is owned by Marwin Saris, a cartoonist who has been making caricatures of photos for more than 25 years. The ordering process involves sending a suitable photo and a description of the desired caricature. | Gifts → Gift Cards 981 | caricature 72 canvas 694 t-shirt 698 application 3377 photo 7778 | |
| joshouweling.nl | Silents Woods | Originally published in 1975 to mark Amsterdam’s 700th anniversary, the ‘700 Centenboek’ was purchased by half of Amsterdam for 7 guilders, with the other half regretting not having bought it. In 2019, Arnold Weel, Moniek Spaans, Henri van Poll, Cor Houweling, Jochem Houweling, and Anne Verhoijsen created additional content alongside pages from the ‘700 centenboek’ as part of an exhibition at Arti. The website also details exhibitions featuring the book’s original copies at Centre Pompidou in Paris, and events commemorating Amsterdam’s 744th birthday and various themes related to the book’s content, such as peace, nostalgia, and confronting difficult subjects. | Resources → Books 3936 | publication 2018 exhibition 5332 book 11396 | North-Holland → Amsterdam 41253 |
| tattoodossantos.nl | Tattoo Dos Santos | The studio specializes in both small designs and extensive sleeves, known for its craftsmanship and attention to detail. The owner, Ailton, is a passionate tattoo artist with a long-standing interest in art and storytelling through tattoos. The studio values a relaxed atmosphere, professional practices, and a personal approach where the client’s wishes are central. | Tattoo & Piercing → Tattoo Studios 202 | tattoo 799 studio 5465 atmosphere 5591 design 27202 | South-Holland → Delft 5309 |
| annabelgc.nl | Annabel Garringa | Annabel Garringa graduated from the Utrecht School of Visual Arts in 2007 as a graphic artist. She uses various graphic techniques, including photopolymer, monoprint, and board cutting, with a particular focus on experimenting and exploring new applications of these techniques. Her work is characterized by an organic and direct approach, where she seeks physical contact with the material, often using her entire body. | Painting → Oil Painting 326 | experiment 229 | |
| fraissinet.nl | Fraissinet | Idonia Fraissinet was a graphic artist who withdrew from the art world due to personal circumstances and consequently fell into obscurity, but her creativity persisted. Her graphic work, characterized by the use of color, was praised by critics. During her studies at the Haagse Academie Amicitia, she acquired various techniques and developed a unique visual style. The website contains an overview of her work, including works not made for exhibitions, sketchbooks, drawings, etchings, lino cuts, and paintings, as well as works by her friends. | Painting → Digital Art 820 | graphic work 21 sketchbook 33 etchings 76 glass 2919 paintings 3907 artist 5745 | The Hague → City Center 445 |
| adridijkhorst.nl | Adri Dijkhorst | The website features a collection of paintings by Adri Dijkhorst, including works depicting flowers, cows, landscapes, and animals. Graphic art and drawings by the artist are presented. The website contains an overview of available works, including specific titles such as 'sheltered by the water', 'the French countryside', and 'fire in the sky'. | Visual Arts → Drawing 1046 Comics & Illustration → Sketches 13 | graphic art 89 canvas 694 panel 868 landscape 2609 flowers 3248 paintings 3907 | |
| bureaugigengack.nl | Bureau Gigengack | The agency offers a wide range of services, including graphic design, copywriting, photography, and wayfinding. The founders, Frank and Dewi Gigengack, describe themselves as a collective of design and text specialists with experience in various media. Bureau Gigengack has previously worked for well-known publications such as Hengelo Magazine and emphasizes combining various specializations under one roof to meet the needs of the client. | Communication → Graphic Communication 145 | wayfinding 48 magazine 2182 text 2467 exhibition 5332 photography 9503 design 27202 | Overijssel → Hengelo 3499 |
| sandravlemmix.nl | Sandra Vlemmix | Sandra Vlemmix graduated as a Master of Arts from the Flemish animation film school MDA in Genk and has since worked as an animator, inker, and portrait painter. She exhibited her work in 2014 and 2015 at Artevent in Helmond and has participated in several internationally showcased and awarded animated films via Mooves. In 2019, her portrait ‘my …… is laughing again’ was displayed in the Rijksmuseum in Amsterdam, within the exhibition ‘Long Live Rembrandt.’ In 2020, she received a nomination for the National Portrait Prize with her portrait ‘me in the hallway.’ | Children’s Books → Comic Books 96 | graphic novel 16 animation 1777 portrait 3685 | Amsterdam → South 1488 |
| gielenreclame.nl | Gielen Reclame | Gielen Reclame is a family-run business located in Valkenswaard that has been active in the visual communication and advertising sector since 1999. The company offers a variety of services, including car wrapping, facade lettering, event displays, and custom-made solutions. The website showcases a portfolio of projects and offers an online shop with high-quality sticker kits. Furthermore, the company's Instagram activities are displayed. | Advertising → Lettering 569 | facade lettering 11 carwrapping 127 visuals 207 exhibition 5332 | |
| kleurenwaaiershop.nl | KleurenwaaierShop.nl | The website sells various RAL, NCS, and Pantone color palettes. Customers can also purchase RAL color charts here. The website offers an overview of various RAL colors, such as K7, K5, and D2, as well as NCS and Pantone colors. | Building & Materials → Paint 923 | ral 16 color palette 56 | |
| deco-lichtreclame.nl | Deco Licht & Reclame | Deco Licht & Reclame has been active since 1982 and specializes in the design, production and installation of various advertising products, including logos, facade and vehicle park lettering, interior decoration, and branding. The website describes a broad offering of services ranging from free-cut lettering and lightboxes to car lettering, company vehicles, flags, banners, and company presentations. Deco Licht & Reclame offers complete solutions for internal and external communication, including furnishing showrooms and offices, and restyling of gas stations. | Advertising → Lettering 569 | lightbox 14 sign 126 letter 834 signage 838 branding 4614 logo 4660 | |
| alternieuw.nl | Stichting Alternieuw | The website offers blueprints for building Boemklats, homemade firework rockets that can be built together with neighbors and friends. Instructions and demonstrations are provided for fireworks dancing, where visitors transform into light balls or fountains. Alternieuw encourages visitors to share their creations and promotes a community around sustainable and festive alternatives to traditional fireworks. | Parties → New Year’s Eve 71 | blueprint 145 | |
| femkewesly.nl | NoBox | Femke Wesly is a musician who creates music, teaches, and undertakes various creative projects. She has a YouTube channel with her music and an independent label, NoBox, established in 2021. The website contains information about her discography, projects, and a contact form. | Composition & Theory → Composition 402 | label 819 film 3007 music 13170 | |
| digitale-karikaturist.nl | Radboud Wanders | Radboud Wanders is a digital caricature and portrait artist who works on location, primarily using an iPad and Wacom Via. The website describes various services, including the creation of party cartoons, quick portraits, caricatures, realistic portraits, and T-shirt cartoons. Radboud offers both individual creations and collaborations with multiple caricature artists, with cartoons being created digitally or on coasters. | Theme Parks & Entertainment → Entertainment 7940 | caricature 72 cartoon 160 ipad 404 drawing 1101 portrait 3685 party 5928 | |
| edprint.nl | Edprint | The website offers a range of printing products, including branded printing, cards, brochures, booklets, posters, flyers, and print mediation services. Edprint emphasizes ease of use, simplicity, reliability, and flexible delivery times as key features of its services. Contact information for Edprint, including the address of Edwin te Molder in Groenlo, is available on the website. | | brochure 1642 card 1975 print 5511 | Oost Gelre → Groenlo 421 |
| staatsieportretten.nl | RVD | New portraits of King Willem-Alexander and Queen Máxima were created in 2023 by Anton Corbijn in the Gallery Hall of Paleis Noordeinde. These portraits are available for private, non-commercial, editorial, public display, and educational use, and can be downloaded directly from the website. The portraits are printed on sustainable canvas or fine-art paper using a 12-color giclée printer, which is then professionally varnished for protection and enhanced colors, with options for online payment and free shipping. | Retail & Commerce → Goods 20 | giclée 15 canvas 694 portrait 3685 order 6912 photo 7778 | The Hague → City Center 445 |
| arisengel.nl | Aris Engel | Aris Engel, born in 1946, has been focused on etching since the late 1990s after a period where it had been less prominent. He describes etching as a physical craft, involving hard work and physical exertion alongside the creative aspect. His work is often linked to nature in its broad sense and is produced by layering multiple plates with different colors. | Arts & Culture → Art Education 594 | etching 48 scratch 81 graphic art 89 plate 787 work 3122 nature 9094 | |
| abkl.nl | Artstudio ABKL by Kevin Langedijk | The Colorbomb paintings showcase vibrant colors and contrasts, but beneath that cheerful appearance lies a critical message about the false perfection often presented. The 'Kiss My Moss' series is inspired by Kate Moss and her unique combination of toughness and nonchalance, utilizing thousands of dots to create a graphic, retro-inspired look. The artist, Kevin Langedijk, aims to capture the dynamic energy and impactful images in his work. | Painting → Contemporary Painting 452 | muse 13 grid 85 series 644 paintings 3907 color 4159 | |
| janmastenbroek.nl | Jan Mastenbroek | Jan Mastenbroek, born in 1971, is a self-taught artist with a long-standing interest in diverse techniques and a childhood passion for drawing, particularly comic strips. Since 1997, he has focused on creating murals and began operating his own business in 2000. He has expanded his interests to wood carving and ice sculpting, utilizing a variety of materials. Jan Mastenbroek creates independent work and commissioned pieces, ranging from landscapes and marble imitations to wood imitations, and offers workshops. | Visual Arts → Installation Art 576 | wood carving 58 mural 338 paint 8747 workshop 19325 | |
| kimstattooparadise.nl | Kim's Tattoo Paradise | The website introduces Kim van der Zouw as the owner and tattoo specialist with years of experience. The company offers a wide range of tattoo styles, from small designs to portraits and color techniques. The website also describes permanent makeup and piercings as offerings, and provides positive reviews from customers. | Art Forms → Tattoos 381 | piercing 157 permanent makeup 702 tattoo 799 reviews 3172 portfolio 6854 appointment 13510 | Netherlands → Groningen 23734 |
| mirianzimmerman.nl | Atelier Galathea | The website describes Zimmerman's artistic focus on landscapes, using structures, space, contrast, and color to represent emotions and experiences. Recent exhibitions and events are listed, including collaborations with other artists and events such as South Explorer. The website also displays various types of artwork, such as paintings, graphic art, and cyanotypes, and provides information about art education and commissions. | Painting → Landscape Painting 186 | graphic art 89 landscape 2609 paintings 3907 exhibition 5332 education 13471 | |
| elsbethveerman.nl | Elsbethveerman.nl | Elsbeth Veerman's artistic foundation is found in her immediate surroundings, specifically in the countryside of Zundert, and she observes the natural cycles of the year. Her work encompasses primarily paintings, gouaches, drawings, and graphic art, often in collaboration with art and nature-related projects. The website offers information about her work, projects, and her CV, including news updates and contact details. | Painting → Contemporary Art 805 | paintings 3907 artist 5745 nature 9094 | North-Brabant → Zundert 756 |
| josverschaeren.nl | Jos Verschaeren | The website provides an overview of Jos Verschaeren's activities, including folios, boxwood constructions and screen prints, and other artistic projects. From July 24th to August 31st, 2025, an exhibition will take place at Radio Kootwijk, where artists are inspired by this historic location. Jos Verschaeren will present two new works there, and there is also a ‘tussentijd’ exhibition to see until September 14th, 2025. From June 14th to September 14th, 2025, there is a ‘tussentijd’ exhibition in the inner courtyard of the Franciscus-Xaverius church in Amersfoort, featuring the work of 12 artists. Jos Verschaeren contributes with the work ‘asylum’, a mobile mini refugee center. Thereafter, an exhibition 'how god disappeared from Ravenstein' will be held from March 21st to 30th, 2025 with photographer Theo Audenaerd. | Galleries & Exhibitions → Exhibitions 1083 | refugees 340 gallery 1983 work 3122 exhibition 5332 artist 5745 | Oss → Ravenstein 246 |
| simonehuy.nl | Madoo | Simone Huy primarily works with oil paintings, starting with sketches that are then developed into oil paintings. In addition to paintings, she also produces graphic art in the form of linocuts and dry needle drawings. Her work is predominantly landscape-oriented and inspired by the nature around Bussum and locations such as Katwijk aan Zee, Zeeland, and the Wadden Islands. | Comics & Illustration → Sketches 13 | oil paintings 25 graphic art 89 landscape 2609 | Katwijk → Katwijk aan Zee 616 |
| wimnoordam.nl | Fine Graphic | The website features an online shop with a selection of graphic art works by Wim Noordam, including landscape, industrial, and nostalgic art. Customers can have custom artwork created and arranged to be framed. The website publishes news regarding projects, exhibitions, and other activities of Fine Graphic. | Art Management & Sales → Art Sales 27 | commission 609 artwork 2248 exhibition 5332 shop 6483 | North-Brabant → Roosendaal 2677 |
| ans-art.nl | Ans van der Zweep - Heijmen | Ans van der Zweep is an autodidactic artist specializing in etching, using her sensitivity to convey colorful, humorous, and adventurous elements. The etching process is a challenge she embraces with pleasure, continuously learning new techniques and enriching her daily life. Ans van der Zweep has been exhibiting since 1985 and her work can be found in various collections of galleries, companies, and private individuals. | Visual Arts → Printmaking 302 | etching 48 gallery 1983 image 2605 exhibition 5332 artist 5745 | |
| jotas.nl | Jotas | Marjo Looijen creates textile art, including wall hangings and bags, often inspired by artists such as Mondriaan. The website displays a portfolio of various artworks, such as 'De Stijl' wall hangings, 'Hartenwand' artworks in restaurant 't Pestengasthuys', and 'Bladeren op stok'. Photographs and a press release are available that describe the recent textile artworks and present the exhibition in the Hoofdhof, Berkum, in the spring of 2021. | Textile Arts → Crafts 9117 | wall hanging 16 textile art 41 cotton 365 artwork 2248 | Raalte → Lierderholthuis 25 |
| werkenbijwilco.nl | Wilco | Wilco is a graphic company located in Amersfoort that prints books and book-related products for various market segments, including general, scientific, documentary and educational. The company was founded in 1958 and has continued to develop since then, with over 450 employees and a modern machine park. The website presents open positions and describes the various departments, including the Binderij (Binding), Printing Press, Logistics, Business Bureau and Office. | Jobs → Vacancies 1099 | printing press 52 department 269 machine park 642 job postings 676 book 11396 | Utrecht → Amersfoort 8011 |
| franskwakkenbos.nl | Franskifactory | Frans Kwakkenbos is a creative artist with a wide range of interests and skills. His recent work is based on the horizon line and creates strongly cohesive compositions. The website provides information about his recent exhibitions, courses, gallery, and contact details. | Painting → Individual Artists 668 | screenprint 42 woodcut 45 drawings 1329 gallery 1983 photography 9503 | |
| hermasteur.nl | Bax Art Concepts & Services | The artist Herma Steur creates sculptures that connect the visible and the invisible, often by stripping away unnecessary elements. Her work, including sculpture, graphic art, and drawings, is characterized by integrating personal feelings and experiences. The website provides information about her biography, work, and contact details, as well as photos by Roel Burgler and the website of Marty Bax. | | graphic art 89 drawings 1329 value 1352 sculpture 1440 | Wijdemeren → 's-Graveland 196 |
| mathildebindervoet.nl | bindrepied | The website features prints with titles such as 'QUEER', 'Bloot in de Stad', 'Paris, Texas', 'DE ECHTE AMSTERDAMMER', 'POOR THINGS' and 'ER VALT ALTIJD WAT TE SCHREEUWEN IN DE CZAAR PETERSTRAAT'. Various t-shirts are available, such as 'PATATVORK' and 'HEB ER GIN IN', in different colors and materials (screen-printed). The website also sells other products such as cards (set of 10), tote bags and pins, with prices ranging from €7.50 to €12.50. Offers are also displayed. | Men → T-Shirts 603 | pin 73 t-shirt 698 card 1975 illustration 2447 print 5511 | |
| teken-design.nl | Teken Design | The website describes the activities of Teken Design, which focuses on creating distinctive, contemporary furniture, objects, and free art, including graphic art and paintings. Teken Design offers bespoke solutions for interior design and gift items, and also provides workshops such as Suminagashi and furniture restoration. Furthermore, Teken Design advises and mediates in cultural and socially-oriented projects, and facilitates collaboration between artistic disciplines. | Sculpture → Art Objects 48 | graphic art 89 objects 426 furniture 8751 workshop 19325 | Gelderland → Zutphen 2690 |
| alweervincent.nl | y-a-v-a.org | y-a-v-a.org defines his artistic practice as an ‘addiction’ to manipulating pixel generators, tweet bots, and blog posts to create constantly changing works of art. The site features a collection of artworks, including computer-generated Kenneth Martin drawings inspired by chance and order, an open-source typeface based on On Kawara’s “Today Series”, and glitch art collaborations with ax710. Collaborating since 2009, the duo emphasizes a process of continuous change and reflection on the internet’s influence, stating that ‘there is no “art piece”, only change.’ | Conceptual & Interactive Art → Conceptual Art 70 | pixel 18 font 71 change 2580 art 3856 collaboration 16036 | |
| margreetbosker.nl | Stoneart webdesign Groningen | Margreet Bosker currently resides in De Veenhoop, Friesland and creates artwork using materials such as steel, bronze, zinc, copper, and papier-mâché. Her artwork is known for its use of fantasy and mythology as themes. The website also includes a portfolio of cartoonist Lothic, featuring examples of his work, such as birthday cards and sports cartoons. | Illustration → Illustrators 178 | cartoonist 27 cartoon 160 artwork 2248 theme 4015 artist 5745 | Netherlands → Friesland 27911 |
| vanlamoen.nl | Van Lamoen Originals | The studio specializes in logo design, website design, packaging design, and print work. Guus van Lamoen is a renowned artist who exhibits both nationally and internationally, known for his experimental work with lines and colors. The website provides a contact form and mentions Guus’s studio. | Artists & Studios → Galleries 1398 | logo 4660 studio 5465 artist 5745 design 27202 | |
| jokestruik.nl | Graphic Atelier Hilversum | Joke Struik was born in Amsterdam in 1946 and studied to become a drawing teacher there, but ultimately did not pursue teaching. Her interest in graphic techniques arose through the accidental possession of a lithosteen, after which she focused on relief printing and later developed her unique combination of etching and linocut (ets/linosnede). Since 2011, she has been working from the Graphic Atelier in Hilversum and regularly displays her work in exhibitions. | Visual Arts → Printmaking 302 | linocut 31 etching 48 graphic art 89 atelier 1417 technique 2157 exhibition 5332 | North-Holland → Amsterdam 41253 |
| afjspinhof.nl | Fons Spinhof | The website presents Spinhof’s artistic endeavors, including explorations of visual art with the quote 'Every human soul finally finds its destination. Is it not just art to inspire the matter, but.....', and his work with pedestals described as providing tranquility and occupying deserving space. Spinhof's graphic design is described as an interactive process that involves listening to the client and leveraging visual knowledge. Furthermore, he is involved in a project related to the construction of Korinthe, Sisyphus, and the repetitive movement of a stone up a mountain. The website also mentions the Kunsthuis Rosmalen website and highlights current installations such as a repeated reimagining of a ‘lake landscape’ presented as an exploding installation, reflecting the principles of ‘peinture automatique’. | Garden Maintenance → Lawn Maintenance 166 | pedestal 35 graphic design 2042 art 3856 installation 13742 | |
| zaansgrafischcollectief.nl | Zaans Graphic Collective | The website showcases the work of artists such as Peter Sanders, Paul Roosenstein, Kees Versteeg, Jurriën Beumkes, Mieke Cosemans, Judy Arends, Janneke Niezen, Els Borgesius, and Bert Menco. The Zaans Graphic Collective, a group of artists who work together in the former Verkade factory in Zaandam, experiments with various printing techniques, including etching and linocut, and uses non-toxic materials. The website provides explanations of etching techniques, such as acrylic-based grounds, aquatint, copper etching with iron chloride, and zinc etching with copper sulfate, and describes the process of printing graphic art. | | linocut 31 etching 48 printing technique 85 graphic art 89 collective 256 | Zaanstad → Zaandijk 214 |
| jeroenvandewier.nl | Jeroen van de Wier | Jeroen van de Wier offers striking graphic designs and executions for various projects, including restaurants, sports schools, and shops. He describes his style as graphic planes, bold compositions, and vibrant colors, inspired by graffiti, tattoo art, surfing culture, and nature. Jeroen uses various materials such as wrap film, wall stickers, and paint to execute the designs in detail and offers mural paintings and drawing services on commission. | Interior → Wallpaper 1001 Design & Creative → Graphic Services 1003 | surface 130 illustration 2447 color 4159 design 27202 | |
| bartjoo.nl | Bartjoo | The website features an online shop with products such as 'Love', 'Strength', and 'Gifts'. Visitors can manage their orders via 'My Account' and the company can be viewed through the 'About Me' and 'Company' sections. The website provides information on the terms and conditions, privacy policy, and the right of withdrawal of the online shop. | Entertainment → Humor 216 | cartoonist 27 online shop 1310 card 1975 gift 6442 | |
| simonebouwman.nl | Simone Bouwman | Simone Bouwman is a graphic artist known for meticulously crafted work with a strong attention to detail. Her 3D artworks are built layer by layer using a variety of materials, including sand, to create unique textures and colors. The artworks are professionally finished with (bak) frames and radiate through her love of bright colors. | Decorative Arts & Crafts → Craft Art 25 | sand 630 frame 883 artwork 2248 color 4159 artist 5745 | |
| pd-reklame.nl | PD-Reklame | The company offers various services, including illuminated signage, lettering, wayfinding, promotional items, and printed textiles. Their workflow includes brainstorming, discussing possibilities, designing, executing, and maintaining. PD-Reklame emphasizes personal attention, full-service approach, and customer support, and has a long track record of satisfied customers. | Advertising → Lettering 569 Advertising → Advertising Materials 292 | wayfinding 48 letter 834 signage 838 advertising 2302 maintenance 20093 design 27202 | |
| miekecosemans.nl | Mieke Cosemans | Mieke Cosemans is both a visual artist and an art therapist. She graduated from the Hasselt art academy in Belgium in 1998, specializing in free and applied graphic art. She subsequently completed a course in creative therapy (visual arts) and now shares her knowledge with others. | Therapy → Creative Therapy 322 | sketchbook 33 ceramics 1271 therapist 1890 illustration 2447 paintings 3907 artist 5745 | |
| banigo.nl | Banigo | The website offers a selection of organic cotton t-shirts for both men and women, hand-printed with unique designs. Banigo also offers services for t-shirt design and graphic design, with a portfolio of designs and illustrations. The website features a blog with articles on inspiration, such as the influence of music and Persian calligraphy. | Men → T-Shirts 603 | graphic 74 cotton 365 t-shirt 698 print 5511 blog 13392 design 27202 | Overbetuwe → Elst 886 |
| atelierrood.nl | Atelier Rood | Atelier Rood organizes painting and drawing courses and workshops. Courses take place in small groups in Uden, where participants have the space to develop their own style. The website provides information about various types of courses, such as drawing with pencil or charcoal, painting with acrylic or oil paint, and creating animal paintings and portraits. | | drawing 1101 portrait 3685 paintings 3907 studio 5465 paint 8747 course 14728 | Maashorst → Uden 1540 |
| victormeijer.nl | Victor Meijer | Victor Meijer describes his artistic style as technically and detail-oriented, inspired by artists of the 1970s. His work encompasses portraits, free work, and comics, and he has published several books and provided illustrations for newspapers and television stations. He offers portrait work in analog style with digital delivery, and experiments with etching techniques to deepen his work. | Printmaking → Etching 22 | etching 48 comic 59 drawing 1101 portrait 3685 book 11396 | North-Holland → Amsterdam 41253 |
| chrisros.nl | Chris Ros | Chris Ros is an artist and goldsmith who uses various disciplines and materials in his work. His portfolio includes works in visual art (sculptures), graphic art and jewelry, such as rings, pendants and moon crowns. The website also provides information about his 'Dichtwerk', poetry, commissioned projects, exhibitions, and a blog about the IJssel river. | Sculpture → Art Objects 48 | graphic art 89 sculpture 1440 jewelry 4599 exhibition 5332 | Horst aan de Maas → Horst 454 |
| ideeontwerp.nl | Idee Ontwerp | The bureau is located in Zeeland, specifically Noord-Beveland, and offers cheerful and affordable designs. They provide a wide range of services including logos, flyers, invitations, print work, and websites. The website showcases recent commissions and encourages visitors to contact them with ideas or assistance in designing a professional brand identity. | | brand identity 1457 logo 4660 print 5511 design 27202 | Zeeland → North-Beveland 512 |
| coolprinting.nl | Coolprinting | The gallery provides an overview of Boudewijns' graphic art. The website lists media coverage regarding the passing of Leo Boudewijns. Coolprinting.nl holds copyright for all content on the website and is owned by Coolprinting. | Websites → Portfolio Sites 235 | graphic art 89 medium 1293 gallery 1983 artist 5745 | |
| smitsart.nl | SmitsArt Wensen | The artist, SmitsArt, processes personal wishes and daily experiences into visual art, emphasizing the transition from thoughts to manual creation. The website offers a selection of artworks, including paintings, screen prints, and monoprints, with themes such as friendship, family, and music. SmitsArt Wensen utilizes social media platforms like Facebook and Instagram to share their work and connect with the public. | Knowledge → Media 46963 | screenprint 42 friendship 431 paint 8747 music 13170 | |
| maartjemyszka.nl | Maartje Myszka | Maartje Myszka describes her drawing process as creating stories and fragments emerging from thoughts and dreams. Her art reflects her observation of the world, seeking to capture silence and wonder. The website offers a view of her portfolio and connection to her social media profile. | Visual Arts → Drawing 1046 | graphics 123 drawings 1329 illustration 2447 artist 5745 portfolio 6854 | |
| whereithappened.nl | Where It Happened | The website offers various types of posters, including map posters, star posters, and travel posters, all of which can be personalized. Users can add their own locations, dates, and personal messages to the posters, creating unique and personal memories. The posters are sustainably produced using FSC-certified paper and shipped via track & trace package post. | Graphic Design → Poster Design 27 | map 801 poster 837 memory 1641 travel 7210 design 27202 | |
| leonievansantvoort.nl | Leonie van Santvoort | Leonie van Santvoort is a graphic artist based in Eindhoven. Her work includes large-format graphics and objects that combine various printing techniques. In addition to her own creations, she offers lessons in graphic techniques and provides an overview of her CV, publications, and current projects. | Arts & Culture → Art Education 594 | printing technique 85 graphics 123 collage 262 objects 426 lesson 5154 exhibition 5332 | North-Brabant → Eindhoven 11845 |
| grafiek25.nl | Stichting Grafein | The fifth Grafiek Triennial will take place from September 1st to November 30th, 2025, and will have the theme 'Connecting'. Participants can find a printed and online program booklet, and locations can organize their own events with support from Stichting Grafein, which also coordinates the PR campaign. The website offers a way to register activities and for students, it presents information about exhibitions, such as NEXT in Hengelo and the International Print Mail Art Project in Eindhoven. | Art & Culture → Art Events 327 | exhibition 5332 event 45199 | Heerenveen → Jubbega 75 |
| decals.nl | Decals.nl | The company originated from the hobby of its founder, Klaas-Jan van Wendel, of building miniature trucks in scale 1:50 and making his own decals. After the supply of parts for the used printers stopped, it was decided in 2013 to start Decals.nl as an official company, with the possibility to produce decals in various scales. The website now offers the possibility to order decals, including 500 metallic colors, printing on film, and cutting letters/logos, with a focus on high-quality and scratch-resistant quality. | Hobbies → Model Building 1007 | decals 26 model building 183 printer 634 letter 834 film 3007 color 4159 | |
| tegeltjetegeltjeaandewand.nl | tegeltje tegeltje aan de wand | The website offers a fixed collection with various types of tiles, such as tableaus, vouchers, hearts, confetti, flowers, and more. Workshops are offered where visitors can freestyle and create unique tiles. The website provides special care for couples and babies when ordering tiles. | Decor & Furnishings → Wall Decor 1035 | stamp 88 tile 2869 package 6112 workshop 19325 | South-Holland → Rotterdam 25048 |
| veraschoone.nl | Vera Schoone | Vera Schoone graduated from the Art Academy in Haarlem in 2007. Her creative process is based on a continuous search for the past. Her artwork explores themes such as structures, age, decay, and the hidden memories held by old objects, inspired by various sources including prehistoric art and African art. | Visual Arts → Installation Art 576 | assemblage 29 graphic art 89 objects 426 inspiration 4081 exhibition 5332 | |
| lenou.nl | Le Nou Tattou Art In Ink | The website offers the possibility to contact for booking an appointment for a tattoo, with an hourly rate being charged and a deposit of €50,- required for the design. Le Nou Tattou offers a diverse selection of artists with different specializations, such as botanical tattoos, animal portraits, and dotwork. In addition to tattoo designs, Le Nou Tattou also sells art prints and posters, including watercolors of various themes. | Hobbies → Creative Hobbies 412 | tattoo 799 poster 837 artist 5745 appointment 13510 design 27202 | |
| notrakkarton.nl | Drukkerij Stuba | The company is part of Drukkerij Stuba and has extensive experience with paper and cardboard. The website offers an overview of different types of cardboard, such as Off-White, Velvet Cardboard, Glitter Cardboard and Cromatico, available in various colors and variations. The website also sells sample cards and offers possibilities for ordering products via a shopping cart and requesting more information. | Graphic Design → Cards 442 | cardboard 170 shopping cart 1521 theme 4015 color 4159 | Zaanstad → Assendelft 524 |
| taluut.nl | Taluut Ontwerp | The website provides an overview of a diverse range of projects, from books and websites to logos and branding, and various graphic materials such as posters and infographics. Taluut Ontwerp has worked for organizations including the University of Utrecht, De Vrijstaat, the Museum Hoge Woerd, the teacher academy, and the Trimbos Institute. The website features a portfolio of examples of their work, including notebooks, board games, and campaigns around themes such as intangible heritage and environmental management. | Design & Creative → Graphic Services 1003 | publication 2018 branding 4614 design 27202 | Wageningen → De Horsten 23 |
| drukkervanderegio.nl | DRUKKERVANDEREGIO.NL | The company specializes in designing and producing a variety of printing products such as postcards, posters, self-adhesive materials, and technical drawings. In addition, Fortrass offers rental of advertising trailers and printing can be delivered in various formats, from A3 to A0, on roll or loose. The website also offers a wide range of products such as photos on canvas, wall hangings, and roll-up banners, with the possibility of quick delivery within 24 hours. | Design & Creative → Graphic Services 1003 | banner 518 drawings 1329 advertising 2302 print 5511 design 27202 | |
| jansies.nl | Jansies | Jansies is a company that has been known for years among carnival associations in the Netherlands, Belgium, and Germany. The website offers the possibility to have carnival designs, distinctions, and pins custom-made, with an emphasis on custom designs. Furthermore, a selection of products is offered, such as pheasant feathers and white gloves. | Crafts → Glassworking 581 | distinction 15 carnival association 65 pin 73 design 27202 | |
| grafiekjokesierag.nl | Tijdvooreensite | Joke Sierag previously worked at the province of North Holland and has a background in technical drawing and graphic design due to her work at the Land Surveying Service. Her work includes abstract, figurative etchings and combinations of both styles, where color and form are central. Sierag experiments with various techniques, including photographic etchings, where original negatives are processed and lithographs are created. | Painting → Contemporary Painting 452 | lithography 25 experimentation 52 etchings 76 form 679 color 4159 | |
| brinkomega.nl | Brink Omega | The website provides an overview of various folding techniques, such as leaflet folding, map folding, and pyramid folding. Brink Omega boasts 65 years of experience in communication and provides expertise in developing innovative direct mail campaigns. The services include personalization options such as data processing, inkjet printing, coding, and unique numbering, as well as various formats and executions of z-fold cards. | Marketing → Direct Mail & Distribution 286 | folding 36 binding 70 direct mail 75 glue 162 personalization 455 cut 926 | Utrecht → Houten 1677 |
| aipostershop.nl | AI Poster Shop | The website sells posters with unique designs, often based on AI generation, in various series such as ‘Translucent’, ‘Cliffside Minimalism’ and ‘Faces of Color’. Customers can choose from various limited editions, where each print is unique and no longer available to order. Some series have a limited print run of 5 pieces. The website also offers the possibility of custom designs, where customers can specify their own design or style, with no extra costs. | Data Science & Analytics → Artificial Intelligence 1831 | poster 837 ai 2181 art 3856 design 27202 | |
| baarnescher.nl | Baarnaars | The project allows visitors to literally follow in the footsteps of M.C. Escher in Baarn and experience the inspiration behind his work. The website highlights the fascinating contrast between Escher’s global influence and his retreat to the quiet village of Baarn, which remains a place of reflection. ‘Escher in Baarn’ is a community-led initiative, with residents collaborating to make Baarn more attractive and promote a love of Escher’s art. | Vacations → City Breaks 536 | work 3122 inspiration 4081 | Utrecht → Baarn 1628 |
| fantasy-kingdom.nl | American Express | The website sells a wide range of products, including hoodies, sweaters, bed sheets, tote bags, and mugs, all designed by American Express and inspired by fantasy stories. The website offers merchandise based on popular franchises such as Harry Potter, Pokémon, and Disney. The website is available in the Netherlands, Germany, and Belgium, with different currencies. | | hoodies 121 mug 280 merchandise 1061 bag 2399 clothing 9443 | Utrecht Hill Ridge → Driebergen-Rijsenburg 237 |
| tinkerbelle.nl | Tinkerbelle, Airbrush and Special Paint Studio | The website showcases the work of the maker, consisting of airbrushes, paintings and custom paint projects, collected in the gallery. Tinkerbelle offers workshops and courses, including lettering lessons, drop airbrushing and flame airbrushing, for both beginners and advanced learners. In addition to the standard courses, the studio also offers airbrush lessons in the Dordrecht studio and works on orders for businesses and private individuals, including the design of unique ceramic pieces such as urns. | Retail & Commerce → Retailers 754 | airbrush 52 gallery 1983 studio 5465 book 11396 course 14728 | |
| mottow.nl | MOTTOW | MOTTOW provides a range of services, including business cards, invitations, packaging, brand identity updates, and paper advice. The website describes Martijn Otto Wolf as a reliable ‘problem solver’ who completes tasks quickly and efficiently. MOTTOW is located in Groningen and offers customer service from Monday to Friday, 9:00 AM to 5:00 PM. | Design & Creative → Graphic Services 1003 Merchandise & Retail → Stationery 576 | invitation 204 business card 270 paper 770 brand identity 1457 logo 4660 print 5511 | Netherlands → Groningen 23734 |
| rieskleijnen.nl | Atelier Ries Kleijnen | The website contains a biography of Ries Kleijnen, who is inspired by people, animals, and nature. Information is provided about current and future exhibitions, including locations and dates. The website also contains news updates about recent exhibitions. | Galleries & Exhibitions → Exhibitions 1083 | graphics 123 biography 697 paintings 3907 exhibition 5332 studio 5465 | The Hague → Scheveningen 1625 |
| decal-sheets.nl | Decal-sheets B.V. | The website offers various types of decals, including water transfer decals, stickers, numbers, letters, and images for specific themes such as cars, company logos, circus, animals, and emergency services. It also sells print media, such as decal/sticker paper, film, inkjet paper, and laser paper. The website also promotes Model-kits.nl as an online model building shop, and provides links and recommendations for building kits and supplies. | Dogs → Supplies 1005 | company logo 20 decals 26 print media 29 model building 183 stickers 777 car 10865 | |
| kaartjevankoen.nl | Kaartje van Koen | The website offers the possibility to have birthday cards designed entirely to your wishes, taking into account the wishes of the customer and in the style of Koen. Koen designs not only birthday cards, but also original vintage name signs that are available in various styles and colors, suitable for use in the home. Visitors can request a quote for a birthday card or name sign, and view recent examples of designed cards. | Family → Children’s Items 155 | sign 126 card 1975 quote 12863 design 27202 | |
| dedrukwerkmaker.nl | De Drukwerkmaker | The website describes the services of ‘De Drukwerkmaker’ including design, printing, and advice for various products such as flyers, brochures, books, posters and calendars, with a network of graphic specialists. The founder, Henk Jan van der Lugt, describes his 30 years of experience in graphic design and emphasizes the focus on high-quality and creative printing and design solutions. ‘De Drukwerkmaker’ offers complete solutions that combine creativity, printing and advice, and is able to handle both small and large print runs, with an emphasis on customization and professional results. | Web Design → Content Management 293 | border 119 layout 899 print 5511 design 27202 | Overijssel → Twente 2578 |
| ministerievanvisuelezaken.nl | Ministry of Visual Affairs | The agency offers services such as graphic design, interactive design, audiovisual design, logo design, brand identity development, website design, murals, and tattoo design. They have worked on projects including design and painting of the Spelerstunnel Feyenoord Stadion De Kuip, promotional videos, album covers, and video and digital signage production. The bureau also has experience with various art forms such as paintings, pencils on paper, and customization of sneakers and jackets. | | tattoo 799 logo 4660 video 6714 paint 8747 design 27202 | South-Holland → Rotterdam 25048 |
| harryvankuyk.nl | Harry van Kuyk Stichting | Harry van Kuyk was a Nijmegen-based graphic artist and graphic designer known as the inventor of the relief printing technique. His work is characterized by the use of letter, word, and typography, and he often bundled his prints in monumental editions, frequently with accompanying text. Van Kuyk’s relief prints are exhibited and collected worldwide, and he made a significant contribution to Dutch graphic art and book history. | Visual Arts → Art History 449 | typography 155 work 3122 exhibition 5332 book 11396 | |
| gerhildvanrooij.nl | Gerhild van Rooij | The website describes the biography of Gerhild van Rooij, her activities as a cultural journalist for various publishers, and her work since 1977, including exhibitions and commissions both domestically and internationally. The website mentions her participation in events such as Uitwaaien 5.0, where her work is exhibited in collaboration with other graphic artists and the Graphic Center Groningen. The website provides insight into her diverse oeuvre, including photographs, paintings, installations, objects, and graphic design, and refers to documentaries and TV appearances. | Books → Publishers 1040 Visual Arts → Art History 449 | graphic art 89 lecture 1624 publication 2018 exhibition 5332 artist 5745 | Nieuwkoop → North 117 |
| andyvanrens.nl | Deux Tattoo | The website features a photo gallery of recent projects, including sleeves, chest pieces, and mandalas, as reference for potential clients. Andy van Rens describes his initial foray into tattooing as a coincidental development while assisting friends in a tattoo shop, and subsequently specialized in mandala tattoos. The website states that Andy van Rens has become a co-owner of Deux Tattoo in June 2022 and offers contact options via WhatsApp. | Tattoo & Piercing → Tattoo Studios 202 | mandala 93 lego 341 tattoo 799 shop 6483 design 27202 | |
| henrivannuenen.nl | Henri van Nuenen | Henri van Nuenen is a graphic artist who produces independent work, primarily large-format digital drawings, hand-drawn pencil drawings and handmade screen prints. The website presents a range of projects, including workshops, art installations, exhibitions, and solo shows, often focused on the combination of design, form, and visual art. Various projects and works from recent years are displayed, ranging from botanical drawings to thematic series and art projects with theater groups. | | botanical 25 screenprint 42 drawings 1329 | |
| canvasontwerpen.nl | Canvas Designs | The website facilitates the easy design of canvases on various topics, with designs being shipped free and quickly to the customer after order. Users can generate beautiful photos with the help of an AI tool and then select and print them on a canvas. The website offers a variety of product options, including canvas, metal/aluminum and acrylic, with prices starting from €14.95, €21.50 and €18.95 respectively, and shipping to the Netherlands and Belgium. | Painting → Digital Art 820 | canvas 694 ai 2181 photo 7778 paint 8747 design 27202 | |
| sylviaoudkerk.nl | Sylvia Oudkerk | Sylvia Oudkerk is an artist based in Amsterdam who creates colorful paintings, lino prints, and etchings. Her work is inspired by distant travels, life on the water, and views from a boat. Sylvia lives and works on a sailing houseboat, the Wilhelmina, a luxury motorboat from 1924 originally used for transporting sand and gravel. | Painting → Acrylic Painting 547 | etchings 76 paintings 3907 travel 7210 | North-Holland → Amsterdam 41253 |
| bloemenhoed.nl | Jet's Bloemenhoed | The website offers a variety of products including greeting cards with different themes (such as ‘a rose is a rose’), storage folders, matchboxes, gifts and sympathy cards. Jet's Bloemenhoed specializes in painting watercolors on commission, including houses, animals, and boats. They also offer workshops and private lessons in watercolor painting. The website contains a YouTube channel with videos of Jet at work, particularly making wedding bouquets that can be custom-made. | Food → Gifts & Souvenirs 2421 | wedding bouquet 63 greeting card 335 watercolor 369 commission 609 gift 6442 workshop 19325 | |
| hermanpoorterman.nl | Herman Poorterman Graphic Designer | Herman Poorterman is a freelance graphic designer who is directly accessible and flexible in his work. He offers designs for branding, creating greater visibility and recognition for companies. In addition to designing branding, he can offer print support and collaborates with freelancers for larger projects. | Design → Graphic Design 2433 | branding 4614 logo 4660 print 5511 portfolio 6854 | Hellendoorn → Nijverdal 728 |
| wilmar.nl | WilMar Press and Productions | The company has over thirty years of experience in journalistic production and possesses expertise in graphic techniques. They offer services for a wide range of publications, from daily and news newspapers to books and special editions. Collaboration with design studios, printing houses, and internet companies ensures a flexible approach. | Knowledge → Media 46963 | newspaper 396 journalism 632 magazine 2182 production 4582 book 11396 | Apeldoorn → Ugchelen 197 |
| cotton-paper.nl | Cotton-Paper | Elsemarie Aarnink runs a small letterpress and design studio in Haarlem, combining graphic design, fine art, and illustration in her work. The studio offers various services including the creation of birth cards with watercolor, line art, and botanical illustrations, as well as art prints with personalized silhouettes. The process involves designing concepts and creating handcrafted illustrations and printing techniques on thick paper, aiming to provide a unique and personal experience. | Crafts & Hobbies → Craft Products 61 | letterpress 28 paper 770 illustration 2447 design 27202 | North-Holland → Haarlem 8674 |
| ineschriever.nl | Ine Schriever | Ine Schriever was introduced to traditional calligraphy during her studies and developed her own style inspired by Roman, Japanese, and Persian calligraphy. She utilizes diverse techniques such as oil painting, Japanese brushwork, ink on rice paper, watercolor, and linocut. In addition to paintings, she has designed and executed stained glass windows in collaboration with atelier Flos, often featuring themes about femininity, confrontations, and inner movements. | | linocut 31 calligraphy 69 stained glass 317 portrait 3685 paint 8747 | |
| art70wallprint.nl | Art70 Wallprint | Art70 Wallprint utilizes advanced technology to create decorative solutions based on customer wishes, ranging from company logos to artwork and personal photos. The service specializes in printing high-quality images on diverse materials such as walls, glass, and art, and can provide solutions up to 4 meters high. The website also provides free and paid stock photos and assists customers in developing their visual identity, where the image choice is determined in collaboration with the client. | Decor & Furnishings → Wall Decor 1035 | image 2605 logo 4660 print 5511 design 27202 | |
| mariekelos.nl | Marieke Los | Marieke Los operates a traveling studio, housed in a car named Koekepeertje, where she gives workshops, does tattoos, and gathers knowledge about self-sufficiency. She is active as an illustrator, where her drawings are sometimes used as tattoos or on t-shirts, and she also makes her own clothing. Marieke offers model drawing classes, which she considers a valuable exercise for improving observation skills and confidence in drawing. | Arts & Culture → Art Education 594 | art academy 19 tattoo 799 illustration 2447 studio 5465 workshop 19325 | |
| studio-zuid.nl | Studio Zuid | The website showcases the cyanotype prints and maps sold by Studio Zuid. Workshops are offered where visitors learn how to make their own cyanotypes. The website provides information about the annual Laurentiusmarkt in Bemelen, where Studio Zuid will be present. | Local Events → Fairs 707 | cyanotype 11 blueprint 145 date 1112 market 2772 print 5511 workshop 19325 | Eijsden-Margraten → Bemelen 40 |
| stingsandkisses.nl | Stings And Kisses | The tattoo shop has a permanent team and guest artists, offering a wide range of tattoo styles, including realism, line work, color, and black and white. The team at Stings And Kisses emphasizes quality and personal attention, thoroughly discussing the desired tattoo with the client. Customers appreciate the high quality of the tattoo work, the friendly service, and the hygienic conditions in the shop, as evidenced by the positive Google Reviews. | Tattoo & Piercing → Tattoo Studios 202 | tattoo 799 result 1902 style 2348 artist 5745 | North-Brabant → Zundert 756 |
| tekenen-en-schilderen.nl | Jacco | The website presents an overview of various course offerings, including ‘Watercolor for Beginners & Advanced’, ‘Teken je Leven’ (Sketchbook Drawing), and drawing courses for different levels and days. Specific courses are offered with start dates and durations, such as a Watercolor course starting on Tuesday afternoon, September 9th, 2025, in Ridderkerk, and a Sketchbook Drawing course starting on Thursday afternoon, October 2nd, 2025. The website offers the opportunity to download courses via a digital textbook and provides information on when courses will be offered again through newsletters or contact. | Education → Adult & Continuing Learning 6510 | sketchbook 33 textbook 73 watercolor 369 drawing 1101 paint 8747 course 14728 | South-Holland → Ridderkerk 1335 |
| kvddesigns.nl | KvD Designs | The company originated as a hobby and now offers a wide range of designs, including animal paintings, fantasy designs, abstract designs, and combinations of existing designs with photos. Customers can choose from existing collections or have a unique design created. They also offer a service where designs are photoshopped onto a wall for a preview. KvD Designs delivers its products in the Netherlands and Belgium and offers various materials and formats, including round, oval, and wallpaper variants, as well as Diamond Paintings. | Decor & Furnishings → Wall Decor 1035 | photo editing 42 wall decoration 101 canvas 694 design 27202 | |
| loof-ontwerp.nl | Loof | The studio provides services such as website design and redesign, illustrations, marketing material layout, animations, and the development of brand styles and logos. Loof distinguishes itself through a clear and fresh approach to design and an integrated approach, prioritizing the client. Clients are welcome to contact the studio for a free consultation to discuss the offered services. | Graphic Design → Infographics 85 | brand style 276 brochure 1642 animation 1777 illustration 2447 logo 4660 | Utrecht → Baarn 1628 |
| adinda-eerlijkehandel.nl | Adinda | Adinda imports handmade maps and olive wood images from small producers in Africa, Asia, and the Middle East. The products are manufactured by individuals facing various challenges (disability, religion, political status, former profession) who struggle to provide for themselves. Through the sale of these products, these men and women generate an income and are respected. | Commerce → Fair Trade 191 | maps 331 producer 464 online store 905 | Zwijndrecht → Poets' District-West 211 |
| martinedesoet.nl | Martine de Soet | The website displays a variety of artworks by Martine de Soet, ranging from paintings to illustrations and postcards. The website informs about the artistic style of Martine de Soet, characterized by color, form, and an element of mystery, often inspired by nature. The website provides information about workshops offered by Martine de Soet, and offers an overview of her career and background. | Painting → Acrylic Painting 547 | wall decoration 101 postcard 278 illustration 2447 art 3856 paintings 3907 workshop 19325 | |
| telegraaf-archief.nl | Telegraaf Archief B.V. | The website sells old copies of ‘De Telegraaf’ in good condition, available for order at telegraaf-archief.nl. Customers can receive a ‘Certificate of Authenticity’ to prove the authenticity of the newspaper. Newspapers are delivered with gift packaging and the option to add a personal message, and arrive within 2-3 business days. | Books → Publishers 1040 | newspaper 396 certificate 1036 archive 2067 gift 6442 | |
| kalligrafie-atelier-amsterdam.nl | Kalligrafie Atelier Amsterdam | The website describes the origins and resurgence of calligraphy as an art form, which was revived in the 20th century by Edward Johnston and Rudolf Koch. Maria Links was previously active in teaching calligraphy, handlettering, and modern calligraphy courses, workshops, and private lessons until the lockdown. Currently, she is primarily focused on drawing and presents examples of ongoing projects on the 'My Work' page. | Arts & Culture → Arts Subjects 64 | handlettering 45 calligraphy 69 drawing 1101 | North-Holland → Amsterdam 41253 |
| geportretteerd.nl | Boy Boelhouwer | The website describes the possibilities for commissioning portraits of buildings in various artistic styles and formats. It is possible to enrich the portraits with elements such as portraits of the owners, logos, or decorations. The website offers several options for delivering the portraits, including prints on archival paper, digital images with user rights, and signed prints. | Painting → Watercolor 274 | pen 210 watercolor 369 buildings 898 image 2605 portrait 3685 gift 6442 | Leidschendam-Voorburg → Voorburg 1234 |
| grafischontwerp-in.nl | grafisch ontwerp in nederland | The website provides an overview of high-quality graphic designers in the visitor's local area. Users can participate in a public encyclopedia with hundreds of articles on related topics. Visitors can search for graphic designers based on location or specialization, and compare prices and quality of services and goods. | Office & Workspace → Business Directories 421 | encyclopedia 203 designer 571 reviews 3172 article 6000 price 8328 | |
| ellentijmes.nl | Ellen Tijmes | Ellen Tijmes is a painter with over 30 years of experience, focusing on creating paintings, drawings, monoprints, and collages. Her work explores themes such as 'freedom and boundaries' and 'what is there to discover?', with a focus on experimenting with materials and techniques. The website also provides information about exhibitions, art markets, and the sale of her artwork via a separate page, set up from November 1, 2019. | Visual Arts → Collage 114 | monoprints 14 collage 262 creative 539 drawings 1329 paintings 3907 exhibition 5332 | |
| e-adesign.nl | E&A Design | The website sells a diverse selection of products that can be printed, such as textiles, wall stickers, window film, nameplates, mugs, and piggy banks. In addition to the printed products, the website also offers a number of standard products, such as fashion items and stationery, which cannot be customized. Orders can be placed that will be processed from July 9th, 2025 onwards. E&A Design will be closed for vacation from June 1st to July 8th, 2025. | Clothing → Printed Apparel 14 | wall stickers 55 stationery 286 textile 1421 print 5511 gift 6442 | |
| muralis.nl | MuraliS | MuraliS specializes in creating eye-catching wallprints using a laser printer, directly printing photos and artistic impressions onto walls. The prints are possible on various substrates, in different sizes up to 4 meters high and infinitely long, and offer a wide range of possibilities for individual customers. MuraliS also offers the possibility of engaging a graphic designer, illustrator, or artist to create unique designs, and guarantees a high ‘Wow-feeling’ with every wallprint. | Woodworking → Engraving 341 | laser printer 10 photographer 1366 wall 1378 idea 2367 design 27202 | |
| cromtownink.nl | Cromtown Ink & Art | The tattoo shop is based in Krommenie but operates within a wider regional area. Cromtown Ink & Art offers tattoo services and mural painting. The business is GGD-certified and has many years of experience, resulting in satisfied customers. | Sculpture → Visual Arts 4165 | mural 338 tattoo 799 artwork 2248 | Zaanstad → Zaandam 2740 |
| leuntje-merien.nl | Leuntje & Merien Webshop | The webshop offers a diverse selection of products, including clothing, postcards, mouse pads, mini shirts, tiles, mugs, bags, and piggy banks. Customers can also have personal drawings made by artist Jan-Willem Hament, which he offers as gifts or for personal use. The products are divided into categories such as Originals, Personal Art, and Offers. The website emphasizes a secure and fast order process, including free shipping from a certain amount, and guarantees a secure payment processing. | Shopping → Nvt 108 | canvas 694 drawing 1101 artist 5745 | |
| inkmywholebodywaalwijk.nl | Ink My Whole Body | The website showcases the studio’s services, including tattoo design and piercing application. The company features a gallery of work from various artists employed, such as Richard, Quinten, Dmitri, and Gonnie. The website includes information about scheduling appointments and canceling them, as well as a privacy policy and a frequently asked questions section regarding prices and contact details. | Cosmetics & Aesthetic → Cosmetic Procedures 157 | piercing 157 tattoo 799 studio 5465 appointment 13510 design 27202 | |
| creativeshapes.nl | creativeshapes.nl | The website provides services such as design, printing, and sticker/lettering. The company collaborates with clients to discuss their wishes and create an appropriate design. Products are only printed after the customer is satisfied with the result. | Advertising → Graphic Advertising 10 | graffiti 243 letter 834 advertising 2302 print 5511 design 27202 | |
| drukproef.nl | Drukproef | The company offers a wide range of services, including printing, advertising materials, gifts, and lettering. Drukproef works with an extensive network of printing houses to find the best deals for its clients, balancing quality and price. With 39 years of experience in the graphics industry, Drukproef has built a valuable and reliable network. | Design & Creative → Graphic Services 1003 | letter 834 advertising 2302 print 5511 gift 6442 | |
| lauracarina.nl | Laura Carina | The website features an online shop where visitors can purchase illustrations and lino prints. Laura Carina organizes lino print workshops where participants can create their own prints and linocuts. The website includes information on shipping and return policies, as well as an Instagram link to stay updated on new products and workshops. | | instagram 1216 illustration 2447 workshop 19325 | |
| grafiekprijspimolivier.nl | Stichting Pim Olivier | The website provides information about Pim Olivier, a city graphic artist who played a significant role in the Graphic Atelier Hilversum in the 1960s, 70s and 80s, serving as an inspiration for artists in the region. The Graphic Prize is awarded annually since 2021 and includes a work-study program worth €10,000 for a graphic artist who will work on a project at the Atelier for six weeks. The website also contains a list of past winners, as well as press releases and updates about the prize awards and the application process. | | artist 5745 | North-Holland → Hilversum 4397 |
| jhmeijerstichting.nl | Johannes Hendrik Meijerstichting | The foundation was established in memory of Johannes Hendrik Meijer, former director of Vernhout & Van Sluijters and board member of the Stichting Bevordering Grafisch Onderwijs. The foundation offers the Johannes Hendrik Meijer Prize, which is awarded annually to a winner. Students from the final year of the Graphic Design program at the Mediacollege Amsterdam are eligible for this prize. | Artists → Dutch Artists 176 | prize 621 graphic design 2042 foundation 6678 student 7623 education 13471 | |
| zwaanblog.nl | Zwaan | The website displays diverse projects, such as ‘Dotted Lines’ with perforations and ‘Artis trees’ with books made of bark. There are examples of specific projects for well-known brands, such as ‘Mooi’ with a brand identity by Doutzen Kroes, ‘Anna den Drijver: ___ & Whip it’ with various cover designs, and ‘The Black Swan 2019’ with fluor-drenched printing inks. The website also presents projects for institutions like the Rijksmuseum, with a leporello about Christ and a catalog of the ‘Best Kept Books’. | Painting → Contemporary Painting 452 | cover 392 book 11396 design 27202 | |
| frankdeman.nl | Frank De Man | The website presents a diverse portfolio of projects where Frank De Man has provided his services as an illustrator and graphic designer. He offers services such as logo design, folder production, and cartoon illustrations, and is open to new creative challenges. In addition to the portfolio, the website outlines his working process and provides information on associated fees. | Film → Animation 868 | cartoon 160 folder 300 illustration 2447 logo 4660 design 27202 | South-Holland → Waddinxveen 1046 |
| arabische-kalligrafie.nl | Evelien Gargasch Bakker | Evelien Gargasch Bakker offers calligraphy workshops, alongside tattoo design, combining traditional and modern techniques. Her work is based on Arabic calligraphy, both handmade and digitally, and is used as free art and for commissions. Evelien’s interest in Maghrebi culture, gained through her studies and time in Morocco, influences her work, expressing the complexity and beauty of local traditions. | Textile Arts → Calligraphy 80 | calligraphy 69 morocco 95 qigong 287 world 321 tattoo 799 art 3856 | South-Holland → Leiden 7089 |
| ankiepostma.nl | Ankie Postma | The website offers an overview of Ankie Postma's oeuvre, covering paintings and graphic art. It provides a catalog of recent and past exhibitions featuring Ankie Postma at various art centers and galleries, including dates and locations. The website contains information about various group exhibitions in which Ankie Postma participates, often in collaboration with other artists. | Galleries & Exhibitions → Exhibitions 1083 | graphic art 89 paintings 3907 exhibition 5332 artist 5745 | North-Holland → Haarlem 8674 |
| mariusvanderput.nl | Marius van der Put – Grafiek & Meer | The website offers an overview of various artworks, including 'Kleurenpracht' series, 'Duinrug' and 'Duinlandschap' series, which represent different landscapes and subjects. Marius van der Put creates works in various techniques such as acrylic, watercolor, etching, woodcut and ink, with a clear focus on nature and landscapes. The website also contains works from Cornwall and Bretagne, as well as archives, recent reactions and links to social media, including Facebook. | Painting → Acrylic Painting 547 | etching 48 watercolor 369 acrylic 506 landscape 2609 | North-Holland → Texel 2208 |
| gemmaoosterhof-shop.nl | Gemma Oosterhof Shop | The shop offers a variety of products, including risoprint, stickers, and prints, with prices ranging from €1 to €290. Customers receive a free New Year’s card with every order. Graphic and art workshops are also offered. The website also includes information about the owner, Gemma Oosterhof, and a contact page, as well as general terms and conditions. | Retail & Commerce → Commerce 8244 | sticker 221 postcard 278 print 5511 workshop 19325 | |
| morgansartshop.nl | MorgansArtshop | The online shop sells drawings and commissions, utilizing materials like graphite, charcoal, and pastel. MorgansArtshop offers handcrafted illustrations and artworks that add a special touch to moments, spaces, or gifts. The website provides prints of artwork and illustrations, alongside a portfolio showcasing diverse creative works. | | drawing 1101 illustration 2447 print 5511 portfolio 6854 | |
| grafiekeggink.nl | Grafiek Eggink | The artist practices graphic techniques in his studio in the center of Zierikzee. His work is primarily based on high-pressure and deep-pressure, which are further expanded with other elements. Grafiek Eggink is organizing an exhibition in the Vleeshal Middelburg from December 21, 2024, to January 5, 2025. | Local & Regional Focus → Local Businesses 1077 | high-pressure 10 graphic 74 exhibition 5332 studio 5465 | Schouwen-Duiveland → Zierikzee 705 |
| christineboerart.nl | Christine Boer | The site contains a biography of Christine Boer and an overview of her various artworks, including cut etchings, drawings, and etchings/monoprints. A key theme in her work is the ongoing change of nature, inspired by the philosophy of Heraclitus about everything being in motion - from cyclical changes in nature to the irreversible climate change. Dr. A.M. Spijkerboer describes how Christine Boer uses the Dutch landscape as a starting point, searching for both regularity and chaos and the patterns hidden within them. | Environment → Climate Change 479 | pattern 2012 artwork 2248 change 2580 landscape 2609 nature 9094 | |
| bartbooks.nl | Bart Gladdines | Bart Gladdines is a book designer with over 250 projects, with a background in graphic design and extensive experience at a printing house. The website presents a selection of books from various genres – cultural, historical, literary, scientific, and spiritual, emphasizing the importance of preserving stories. The website, designed by Leonie Gladdines of Studio Sierlebons, includes information about Bart Gladdines' work, his font (BartSans), and contact details. | Protestantism → Churches 1009 | bookcase 40 font 71 heritage 818 story 8285 book 11396 design 27202 | North-Brabant → Breda 9003 |
| margrietvantilborg.nl | Margriet van Tilborg | Margriet van Tilborg studied at the Higher School for the Arts in Kampen and specializes in acrylic paint. She utilizes various graphic techniques, including screen printing, monotype, etching, and collagraph, to capture the play of lines and structures. The website provides an overview of her work and the processes behind her creations. | Visual Arts → Printmaking 302 | etching 48 screen printing 128 acrylic paint 204 graphic design 2042 nature 9094 | |
| artisjok-mobiel.nl | Atelier op Locatie Artisjokmobiel | The organization provides workshops for adults, young people, and children, geared towards team building and festive occasions. Atelier op Locatie Artisjokmobiel hosts workshops and works in a natural environment and near cultural heritage sites. The workshop produces greeting cards and prints according to their own designs and supplies them to shops in the Netherlands and Belgium. | Painting → Digital Art 820 | visual art 136 greeting card 335 craftsmanship 1858 print 5511 nature 9094 workshop 19325 | |
| artbyml.nl | Gallery Mi-Lou Beugeling | In 2017, Mi-Lou Beugeling began creating collages, inspired by an exhibition she saw. Her work is characterized by combining unexpected images into harmonious compositions, often focusing on flowers and women. Beugeling describes cutting and collaging as a meditative and creative process, aiming to evoke a sense of wonder. | Painting → Mixed Media 64 | mixed media 104 collage 262 composition 639 canvas 694 image 2605 flowers 3248 | |
| huwelijkskaartonline.nl | Drukkerij Gilles Hassing | The website offers various types of cards, including birth cards, wedding cards, and wedding texts. Drukkerij Gilles Hassing has over 40 years of experience in creating cards with various printing techniques such as letterpress, embossing, and foil printing. Customers can request a quote online or submit their own design. | Graphic Design → Cards 442 Commerce → Greeting Cards 430 | wedding card 31 birth card 69 printing technique 85 card 1975 quote 12863 design 27202 | North-Holland → Alkmaar 6507 |
| dyman.nl | Dyman Graphic Design | Peter van den Berg is a graphic designer with over twenty years of experience working for various clients. The website includes a portfolio showcasing previous projects and clients. Dyman Graphic Design is known for its creative and functional approach to design. | Design → Graphic Design 2433 | designer 571 portfolio 6854 design 27202 | |
| grafischbedrijfardon.nl | Grafisch Bedrijf Ardon | The company offers services such as gathering, folding, cutting, binding, sealing, and the use of a new tabber/label machine. They utilize both automated processes for medium to large print runs and manual processing for smaller runs. The company has purchased a paper drilling machine to accurately create holes in printed materials. | Logistics → Packaging 1094 | folding 36 binding 70 seal 264 gathering 394 machine 3727 | |
| bruiloftskalligrafie.nl | Bruiloftskalligrafie | The website specializes in wedding calligraphy, emphasizing the creation of tangible memories for wedding celebrations. In addition to wedding calligraphy, marriage albums, anniversary cards, and name cards are customized with handwritten calligraphy. The website also offers services for marking anniversaries with unique calligraphic artworks and describes the passion for craftsmanship and the creation of personalized art pieces. | Weddings → Wedding Accessories 20 | calligraphy 69 anniversary 670 wedding 4258 | |
| the-i-company.nl | The I Company | The company offers services such as film production, product photography (packshots), and the creation of multimedia content. Films are produced using various techniques, including 4K film, photos, graphics, animation, avatars, text, voice-over, music, and extras, and sometimes with the use of drones. Since 2016, the company has also held a license for the professional operation of drones up to 4 kg. | Architecture & Design → Creative Industries 1157 | graphic 74 drone 936 film 3007 production 4582 brand 17737 | |
| tekstenopcanvas.nl | Canvas Text B.V. | Visitors can browse a selection of existing text on canvas designs in various colors, fonts, and styles, catering to different spaces like living room, bedroom, and children's room. The website provides the option to design a custom text on canvas, with choices of color palettes, fonts, and design styles. A free design request is offered. The website includes information about sizes, prices, and product details, as well as frequently asked questions about ordering text on canvas. | Decor & Furnishings → Wall Decor 1035 | font 71 canvas 694 text 2467 inspiration 4081 color 4159 design 27202 | |
| studio-kaa.nl | Studio Kaa | The studio provides graphic design services, including prints, collages, drawings, birth cards, wedding cards, and logos. Creative workshops are offered, primarily monoprint and blockprint techniques, as well as lessons and workshops for children. Studio Kaa also offers interior design services and assistance with organizing/visualizing ideas for personalized designs and gifts. | Arts & Culture → Art Education 594 | idea 2367 logo 4660 lesson 5154 print 5511 workshop 19325 design 27202 | |
| rianneleemhuis.nl | Rianne Leemhuis | Rianne Leemhuis is an artist who practices graphic design, monotype and block printing, and also offers creative guidance. She provides drawing lessons and workshops for children and adults, focusing on expressing feelings through art. Her work includes graphic techniques such as monoprints, block printing and linocut, as well as painting, drawing and mixed media. | Painting → Figurative Art 177 | drawing 1101 workshop 19325 | |
| ceesalfrink.nl | Cees Alfrink | Cees Alfrink is a graphic artist specializing in traditional etching techniques and pigment prints. He utilizes both analog (etching, aquatint) and digital techniques (photo manipulations, digital collages) to create his art. A significant part of his work is a series of pigment prints inspired by Greek mythology. The prints are printed on high-quality paper. | Painting → Digital Art 820 | etching 48 digital art 59 paper 770 | |
| josuma.nl | Josuma Grafische Afwerking | The website provides information about the services offered by Josuma Grafische Afwerking, including cutting, folding, embossing, and the production of sewn and unsewn brochures. The company emphasizes good service and values long-term relationships with its customers. Recent news and events, such as support for Kika and a partnership with Du Cloo, are published on the website. | Marketing → Direct Mail & Distribution 286 Design & Creative → Graphic Services 1003 | graphic finishing 10 folding 36 cut 926 brochure 1642 news 15293 | North-Holland → Aalsmeer 1710 |
| studiospade.nl | Studio Spade | The company offers services such as cover design, setting up and working on layouts (cover and interior), and further optimizing layouts through DTP work. Studio Spade also handles typesetting for co-productions, adapting existing PDF files, and creating EPUB files. Within their services, they also include scanning of images and OCR work, and handling diverse projects from clients, including recent titles and various layout and epub projects. | Design & Creative → Graphic Services 1003 | layout 899 graphic design 2042 | Barneveld → Voorthuizen 541 |
| atelierdegraasj.nl | Atelier de Graasj | Ietje van Roosmalen, born in Maastricht on January 22, 1943, is an artist who values the craft-based aspects of her work. Her creative process is based on slowness and organic development, where she works according to her intuition and the results of her actions. The website offers a glimpse into her interests, education, and diverse artistic projects. | Sculpture → Art Objects 48 | graphic art 89 craft 538 artist 5745 paint 8747 | |
| theogram.nl | TheoGram | TheoGram specializes in designing logos, branding, and print materials for clients. The website also offers services for creating artwork portraits of family members, pets, and vehicles. The owner, Tom Hager, is a graphic designer with over 15 years of experience and a unique style inspired by historical facade paintings, combining design and art. | | portrait 3685 art 3856 branding 4614 logo 4660 print 5511 design 27202 | |
| damgrafischeafwerking.nl | Dam Grafische Afwerking | The website describes the services offered by Dam Grafische Afwerking, including paper cutting, folding, embossing, craftsmanship, maintenance, and outsourcing of graphic finishing. The website emphasizes the importance of expertise in graphic finishing, particularly in the precise cutting and folding of paper. The owner of the website, Dam Grafische Afwerking, offers flexible services as a freelancer and is available for various assignments and temporary assistance. | Marketing → Direct Mail & Distribution 286 | folding 36 paper 770 cut 926 assignment 1121 craftsmanship 1858 | |
| vogelkunst.nl | Vogel Kunst op Maat | The website originated in response to the words of Edouard Manet, who envisioned making art accessible to a wider audience through reproduction. An Art-Scanner is used to carefully scan the artworks with multiple directions and lighting angles to emphasize the depth of the paint and maximize reproducibility. The printed artworks are produced with an Epson printer and pigment ink, which offers 75 years of color guarantee, and artists receive a commission for each piece printed. | Business Software → POS Systems 101 | scanner 175 image 2605 work 3122 art 3856 color 4159 print 5511 | |
| marjoleinmarkink.nl | Marjolein Markink | Marjolein Markink was born in 1969 and initially studied at the Arnhem Art Academy, after which she specialized in nautical school. Her work consists mainly of sculptures and installations, often in wood or bronze, combining various materials and techniques. In addition to sculptures, she also makes unique coffins in special shapes, such as boats, and explores themes such as birds, wings, love and vocabulary in her art. | Visual Arts → Installation Art 576 | coffin 185 bronze 225 sculpture 1440 theme 4015 wood 4153 installation 13742 | |
| marianneruisendaal.nl | Marianne Ruisendaal | The website describes Ruisendaal’s artistic practice, where she translates elements of her life into various art forms, including sculpture, graphic art, painting, and etching. Ruisendaal shares her personal journey, beginning with her studies at the Vrije Academie Kennemerland and her experiences with cancer, which led her to explore spiritual practices such as yoga and Chi Neng Qi Gong. In addition to her artistic and spiritual endeavors, Ruisendaal has established a biographical coaching practice, where she guides people through personal development. | Painting → Contemporary Art 805 | etching 48 sculpture 1440 yoga 3704 inspiration 4081 | |
| smrtibooks.nl | SMRTi Books | The website offers children's books, including ‘The Monsterschool’ (for children aged 7+) and ‘Sjaakie & Sheela’ (for children aged 4+). Coloring pages, reviews of the books, and an online shop are available for ordering the books. Varishna Sardjoe Mishre, the author, also regularly shares blog posts about new books, events such as the Diwali Festival and the Children's Book Week. | Books → Children’s Books 1042 | childrens books 51 adventure 919 online shop 1310 animal 2908 book 11396 blog 13392 | |
| cartoonist-inhuren.nl | Cartoon Blanche | Cartoon Blanche is a cartoon studio with over 15 years of experience creating cartoon drawings for businesses and government agencies. The website offers a range of services, such as cartoon drawing, slogans, social media campaigns, visual minutes and visualizations. The cartoonist, Jeroen Verdonschot, emphasizes the importance of visual communication to effectively convey ideas and make them memorable, and offers an express service and customer satisfaction guarantee. | Communication → Visual Communication 409 | comic strip 13 slogan 80 visual communication 115 cartoon 160 visualization 621 | |
| extreme-art.nl | Hard Art Airbrush Studio (H.A.A.S.) | Hard Art Airbrush Studio (H.A.A.S.) offers services such as True Fire and Fantasy Airbrush, cartoons, murals, logo designs, and web design. The projects are executed using airbrush guns, spray cans, templates, and plotters, and are the result of Brian 'Brainz' Langenberg's creativity. The studio is located in Alkmaar, North Holland. | | airbrush 52 cartoon 160 mural 338 creativity 2531 webdesign 4092 logo 4660 | North-Holland → Alkmaar 6507 |
| vintage-flowers.nl | Vintage Flowers | The website features a collection of pressed flower art in various frames, ranging from antique to vintage. Customer testimonials are shared, praising the quality and passion of the maker, Fenna. The website contains information about techniques, the making process of the artworks, and an FAQ section. | Collections & Antiques → Art Collections 87 | collage 262 artworks 460 frames 2556 | |
| label160.nl | Label160 | The site sells hand-drawn cartoon illustrations in a loose cartoon style, created in a digital program. After purchase, the customer receives a PNG file. The website also offers calligraphy and includes a portfolio of completed commissions and examples. The owner, Miranda, lives in the Netherlands and started the website with a focus on Instagram. | Graphic Design & Printing → Typography 82 | calligraphy 69 cartoon 160 illustration 2447 gift 6442 portfolio 6854 | |
| hellodeer.nl | Hello Deer Studio | The website offers various categories of birth announcements, including cards with children and cards with animals. Birth announcements and posters can be customized to your wishes in terms of color, font, format, or with small additions, often without cost. The cards are standardly printed on 300 grams quality recycled paper with a light natural tint. | Decor & Furnishings → Children’s Room 222 | birth announcement 73 paper 770 poster 837 illustration 2447 design 27202 | |
| toothfairystudio.nl | Tooth Fairy Studio | The website offers a range of cyanotype prints and T-shirts, as well as linen bags, all handmade and therefore unique. The production process involves working with negatives and photograms, where objects are directly exposed to light to create a cyanotype, often with light editing in Photoshop. The studio originated from a personal imagination, starting with the observation of a fuchsia that resembled a dancer, and offers the possibility of recreating works, but always with subtle variations. | Crafts → Textile Work 134 | cyanotype 11 screenprint 42 t-shirt 698 print 5511 | |
| ceesdegast.nl | Cees de Gast | Cees de Gast was a Dutch printmaker, lithographer, linocut artist, and painter, born in Hank in the Land of Altena and died in Roermond. Between 1973 and 1981, he developed his graphic techniques and art. His work can be found in various series on the website. After his education at the Sint Joost Art Academy in Breda and the Willem de Kooning Academy in Rotterdam, he moved with his family to Raamsdonksveer and later to Reuver, where he converted an old factory from 1918 into a unique residential and workspace. | Artists → Dutch Artists 176 | graphic art 89 series 644 studio 5465 artist 5745 education 13471 | Altena → Hank 113 |
| cobitenkate.nl | Cobi Ten Kate | The website offers an overview of various artworks by Cobi Ten Kate, including portraits of women, love letters and new works. The portfolio encompasses diverse techniques, such as monoprints, collages, and mixed media, utilizing materials like ink, acrylic paint, paper, and fabric. The website features an online shop where artworks are for sale and a newsletter to stay informed about new works and exhibitions. | Visual Arts → Printmaking 302 | acrylic paint 204 collage 262 portrait 3685 | |
| afscheid-in-kleur.nl | Studio Seen | The website offers possibilities for creating images on coffins, including motifs such as wildflowers, birds, Zeeland horses, landscapes, and children’s drawings. Clients can discuss their wishes with Lucy de Graaf, the owner, and jointly realize a design. The website emphasizes the possibility of incorporating personal elements, such as drawings from children, into the images. | | motif 42 coffin 185 image 2605 landscape 2609 nature 9094 child 11566 | Zeeland → Middelburg 2342 |
| studio-impressed.nl | Studio Impressed | The studio offers a range of services including letterpress foil printing, wax seals, place cards and envelope seals, and also provides options for custom design creation. Studio Impressed emphasizes sustainable production and traditional techniques, with each product meticulously crafted and finished by hand. The website allows customers to order custom cards, upload their own designs, and purchase various types of wax seals and place cards. | Graphic Design → Stickers 277 Marketing & Branding → Paper 93 | seal 264 paper 770 card 1975 design 27202 | |
| jacques-versteeg.nl | JACQUES VERSTEEG | Jacques Versteeg was born on April 23, 1948, in Utrecht. He studied at the Academy for Industrial Design in Eindhoven from 1983 to 1988, specializing in free visual arts. Alongside his full-time job in the book industry and raising a family, Versteeg pursued his artistic endeavors, creating works including paintings, sketches, graphic art, and ‘painting with words.’ | Painting → Individual Artists 668 | visual artist 42 graphic art 89 sketch 271 academy 593 life 2673 paintings 3907 | North-Brabant → Eindhoven 11845 |
| grafischateliermoniquevanhaasteren.nl | Monique van Haasteren | Monique van Haasteren guides visitors through their first encounter with graphic art and supports experienced students in improving their drawing and technical skills. The website describes various graphic techniques, such as dry etching and aquatint, emphasizing that experience is not required to achieve results. Monique van Haasteren, with 30 years of experience as an artist and teacher, offers courses and workshops in Overasselt. | | graphic art 89 atelier 1417 teacher 2890 workshop 19325 | Heumen → Overasselt 151 |
| designadvertising.nl | Design Advertising | The company specializes in a wide range of services, including car wrapping, building signage, window film, textile printing, photo wallpaper, and kitchen wraps. Design Advertising offers a complete service package, from concept development to professional execution and installation, focusing on visual communication and brand identity. The website features examples of their work, including the makeover of Dennis Vollenga's building facade, wallprints for Nutanix, and logo/brand style design. | Printing → Textile Printing 251 | building signage 25 textile printing 73 carwrapping 127 brand identity 1457 print 5511 design 27202 | |
| carolusboudewijn.nl | Carolus Boudewijn Art | Carolus van den Hoogen is a visual artist who has been working on creative projects since his youth. After a period with realistic pencil drawings, he switched to East Indian ink, with his style becoming increasingly less detailed and more minimalist. He discovered wire sculptures through an American artist and decided to practice this art form himself. | Visual Arts → Drawing 1046 | line drawings 11 visual artist 42 drawing 1101 sculpture 1440 | Gelderland → Culemborg 1264 |
| riesh.nl | RIESH - Grafisch Ontwerp | The website showcases various types of work, including portraits, cartoons, caricatures, and illustrations. RIESH offers services for creating personalized mugs and tiles with cartoons through sublimation. Furthermore, a variety of graphic designs are offered, such as posters, flyers, and laser cutting & engraving. | Visual Arts → Drawing 1046 Adult & Continuing Learning → Workshops 611 | caricature 72 cartoon 160 laser cutting 251 mug 280 illustration 2447 tile 2869 | |
| ivonspronck.nl | Ivon Spronck Artist | Ivon Spronck is an artist who has been drawing and painting from a young age, which gives him a relaxing feeling. He has a background as a ‘Games and Movement’ teacher and also focuses on sculpting, with a focus on human form and movement. Currently, he is actively pursuing various training courses in painting and graphics at the Maasmechelen Art Academy. | Artists → Dutch Artists 176 | sculpting 171 watercolor 369 artworks 460 drawings 1329 paintings 3907 course 14728 | |
| weprintforyou.nl | WePrintForyou Fine Art Print | The website offers different types of photo prints on materials such as Dibond, acrylic glass, canvas, framed prints and aluminum, each with different laminate options. In addition to printing, WePrintForyou also offers various decorative solutions such as garden posters, wallpaper, roll banners, flags, magnetic boards and lifelike cut-outs. The website offers the possibility to upload photos and determine the size yourself, and shows examples of previous commissions, including a print from World Press Photo winner Cor Mooij. | Decor & Furnishings → Wall Decor 1035 | dibond 37 magnet 127 canvas 694 poster 837 wallpaper 1756 photo 7778 | |
| bertcartoons.nl | Bert Cartoons | Bert Schoolderman is a cartoonist with extensive experience offering caricatures and cartoons. Customers can request caricatures online or contact Bert for on-site drawing, for example at parties and events. Caricatures are typically drawn on paper in A3 format and delivered within one week. | | caricature 72 cartoon 160 paper 770 drawing 1101 | South-Holland → The Hague 19898 |
| drukkerij010.nl | Drukkerij 010 | The website offers a wide range of products, including clothing, decoration and accessories, including items featuring iconic Rotterdam images like the Erasmus Bridge and windmills. Customers can choose from various photo-printing options on different materials such as canvas, aluminum and textile cloth. Drukkerij 010 offers free shipping from €100,- and facilitates secure online payments. | Men → T-Shirts 603 | canvas 694 decoration 4085 print 5511 photo 7778 clothing 9443 accessories 12975 | South-Holland → Rotterdam 25048 |
| zeldzamezaken.nl | Zeldzame Zaken | The webshop offers a diverse selection of products including glass and crystal, ceramics and porcelain, jewelry, militaria, cartography, and toys. The webshop has a list making service in Uden, where custom-made lists are created, a task performed by Matthieu Beelen. The website also includes an agenda and contact information, as well as general terms and conditions and copyright information. | Home → Antiques & Collectibles 1523 | graphic art 89 brocante 188 antique 432 list 575 glass 2919 | |
| hetiseenkunst.nl | It’s Art | The website offers a collection of products such as cushions, tablecloths, bedspreads, mouse pads, and postcards, all inspired by artworks by various artists. The ‘It’s Art’ collection is designed to keep artworks alive and bring them into daily life, for example, by using them as decorative objects in the home. The website showcases the work of artists such as Claude Monet, Vincent van Gogh, and Rembrandt, with focus on their famous paintings and artworks. | Artists → Dutch Artists 176 | mousepad 10 bedspread 61 postcard 278 cushion 823 art 3856 | Noordoostpolder → Creil 68 |
| harmkuijers.nl | Harm Kuijers | Harm Kuijers is a graphic artist and sculptor specializing in etching and bronze casting. He graduated from the Rietveld Academy in Amsterdam. The website features a portfolio of his recent work, including etchings and bronze sculptures. A full catalog of his artworks is also available for download as a PDF. The site also presents the agenda of FlorRaison, a flower shop, and provides links to Harm Kuijers' blog and webshop. | Visual Arts → Printmaking 302 | etching 48 catalog 812 sculpture 1440 artist 5745 portfolio 6854 photography 9503 | South-Holland → Rotterdam 25048 |
| klev.nl | KLEV | The website offers a birthday calendar with photos of Edam and its cats, created by Marianne Klok. Greeting cards are sold that are artworks with a purpose, and the proceeds are donated to the Stichting Huisje Aafie van de Bibber foundation. KLEV sells a variety of local products, including greeting cards, notebooks, and products related to the categories Edam, Volendam, Accessories and Birthday Calendar. | Local & Regional Products → Local Shops 245 | greeting card 335 calendar 1556 art 3856 | Edam-Volendam → Volendam 948 |
| houtdrukken.nl | David’s CollectiE | The website describes woodcut as a relief printing technique where a drawing is cut from a wooden block and then inked and printed. The author recounts his initial interest in woodcut sparked by seeing woodcuts in the Graphic Museum in Groningen and taking courses with Antje Veldstra. The website details the woodcut process, including cutting the wooden block, applying ink, and printing onto paper. | | woodcut 45 block 91 ink 199 paper 770 technique 2157 print 5511 | |
| lalalines.nl | La La Lines | The website showcases a variety of line illustrations, including portraits of people and animals, birth posters, and 'Where we first met' posters. Custom line illustrations are available with various frame options, such as black aluminum and oak frames. The website also offers gift vouchers for line illustrations and promotes the hand-drawn illustrations as a way to cherish precious memories. | Painting → Digital Art 820 | poster 837 frame 883 illustration 2447 gift 6442 photo 7778 event 45199 | |
| awakeningcreations.nl | Shirley Hoekstra | The website features a collection of digital artwork, including holograms, fractals, mandalas, and maps. Artwork is available as wall decor in various formats and materials through the shop at Werk aan de Muur.nl. Visitors can view artwork in sample rooms and find inspiring texts and poems. | Painting → Digital Art 820 | hologram 14 mandala 93 wall decor 213 maps 331 texts 1218 | |
| anika.nl | Nik van der Meulen | The website features a publication documenting the early stages of a graphic novel project, alongside excerpts from interviews with graduating students at the WdKA. Nik van der Meulen collaborated with Voor Het Kreukelcollectief and Centraal Museum Utrecht on an illustration and animation video concerning the 'Groninger Lijst' exhibition exploring the concept of norms. Several projects are highlighted, including a comic titled 'Medication' addressing obsessive compulsive fears and a poetry collection titled ‘Liefde zit in nog kleinere hoekjes’ with Maurits Boskamp, along with an open call project from the Rijksmuseum van Oudheden. | Comics & Illustration → Comics 53 | graphic novel 16 zine 29 poetry 665 animation 1777 illustration 2447 exhibition 5332 | |
| beautyart4u.nl | Beautyart4u | The website offers a diverse collection of wall decorations, including landscapes, cities, animals, and beauty/art motifs. The decorations can be applied to various materials, such as posters, stickers, wallpaper, canvas, plexiglass and aluminum. Beautyart4u.nl offers custom solutions, such as printing photos on plexiglass and aluminum, and providing high-quality wallpaper. | Decor & Furnishings → Wall Decor 1035 | plexiglass 66 wall decoration 101 aluminum 1197 wallpaper 1756 style 2348 | |
| bedtimemonsters.nl | Bedtime Monsters | The posters are hand-screenprinted, feature glow-in-the-dark ink, and are available with a wooden frame. The monsters, Alfie, Lux, and Brillo, brighten up the room during the day and provide a soft glow at night, creating a cozy atmosphere in the bedroom. The prints are limited editions, illustrated by Idris van Heffen and conceptually designed by Ivar de Jong, and are available starting at €45.00. | Family → Children’s Items 155 | poster 837 frame 883 decoration 4085 print 5511 | |
| casalaink.nl | JustCillOkay | The studio offers a wide range of styles, including fineline, floralpieces, ornamental, black & grey, illustrative, mandala, and semi realism. Clients can have a personalized design created, with a focus on collaboration and the creation of a unique and fitting tattoo. The website presents a portfolio with examples of previous tattoos and the studio offers a free customer service for visualizing ideas. | Tattoo & Piercing → Tattoo Studios 202 | tattoo 799 studio 5465 design 27202 | |
| henkdevroom.nl | Henk de Vroom | Henk de Vroom is an artist who explores abstract visual language through the use of shapes and colors in his work. His work often begins with sketches and collages, where forms are tested and adjusted, resulting in a basic visual language with a focus on vertical lines and long black planes. The portfolio includes an overview of his recent and older works, including paintings, graphics, and sculptures, often using human scale as a starting point. | Painting → Contemporary Art 805 | graphics 123 shape 176 sculpture 1440 paintings 3907 color 4159 portfolio 6854 | North-Holland → Amsterdam 41253 |
| lidievanderminne.nl | Studio Knot | Studio Knot creates custom illustrations, including house portraits, birth tiles, and line drawings, using sustainable paper or recycled plastic from De Jutfabriek on Terschelling. The illustrations are hand-drawn and unique, based on customer photos and wishes, and can be delivered on various materials. In addition to illustrations, Studio Knot offers prints, city drawings, and tote bags in their webshop. | | street 281 paper 770 illustration 2447 tile 2869 house 8121 | Friesland → Terschelling 1034 |
| niedlich.nl | Blue Zenith | The website showcases the artwork of Gregor, who specializes in fine drawings, etchings, and linocuts inspired by nature. Blue Zenith also provides yoga classes and therapy, both in groups and individually, highlighting the benefits of yoga, breathing, and meditation. The website introduces the collaboration between Gregor and Indy, emphasizing their shared life experiences and conversations as a source of valuable insights. | | lecture 1624 meditation 2400 yoga 3704 art 3856 nature 9094 | Noordenveld → Norg 322 |
| oogabooga.nl | Ooga Booga | The website offers a selection of T-shirts, sweatshirts and hoodies, alongside artwork. The products are described as unique, exclusive and surprising, with a constantly changing assortment. The website offers free shipping on orders from €99.95 and a shopping cart with the ability to keep track of the order. | Men → T-Shirts 603 | artwork 2248 ship 5103 assortment 7799 clothing 9443 | |
| printplaza010.nl | PrintPlaza010 | PrintPlaza010 has been active since 2008 and focuses on providing custom solutions in the advertising and lettering industry. The company operates with its own machine park, ensuring quick delivery and quality control. PrintPlaza010 produces a variety of products, including wallcover, stickers, Covid-19 stickers, and textile printing, and also offers installation and application services. | Graphic Design → Stickers 277 | textile printing 73 stickers 777 signage 838 design 27202 | South-Holland → Vlaardingen 1853 |
| tekstenthema.nl | Tekst & Thema | The company, with over 30 years of experience, specializes in the concept, creation, and printing of campaign and promotional materials for various sectors, including shopping boulevards, shopping centers, and small-to-medium businesses. Tekst & Thema provides a complete service package, including writing text and slogans, offering advice on material design, and managing printing and 'point of sale' (POS) materials. The website presents a wide range of products, including business cards, flyers, posters, folders, magazines, menus, and signs, with various sizes and price options. | Printing & Production → Printing 690 | sign 126 business card 270 folder 300 promotion 2062 print 5511 design 27202 | |
| alfonsbraaksma.nl | Pulchri Studio | Alfons Braaksma is a visual artist specializing in realistic paintings, landscapes, portraits, and graphic art. The website displays a selection of his work, categorized as paintings, drawings, graphic art and commissioned artwork. Information about his life, education, completed commissions and exhibition participation is also presented, along with an overview of publications featuring his work. | Artists → Dutch Artists 176 Graphic Design & Printing → Typography 82 | commission 609 drawings 1329 publication 2018 paintings 3907 exhibition 5332 | Midden-Groningen → Muntendam 86 |
| anywayproductions.nl | AnyWay Productions | The website offers a wide range of map types, including camping layouts, city layouts, route maps, and node maps. AnyWay Productions has been active in cartography for 27 years and has evolved from traditional hand-drawn maps to modern maps based on geographic databases and GIS systems. The organization offers complete solutions for location-based data management and works with a network of GIS specialists and experienced cartographers to select the most suitable partner for each assignment. | Software & Computing → Computing 696 | gis 106 map 801 layout 899 route 3425 data 5872 | |
| appendixgrafiek.nl | Stichting AppendiX Grafiek | Stichting AppendiX Grafiek collaborates with artists who use graphic art as a visual language. In 2021, the foundation organized an exhibition in Rotterdam featuring artists from the eastern Netherlands. Currently, an exhibition #Oost#West is being organized in De Vrijhof in Enschede, with work by various artists. | Art & Culture → Art Events 327 | exposure 36 graphic art 89 exhibition 5332 artist 5745 | South-Holland → Rotterdam 25048 |
| artistworks.nl | HILTERMANN ART SERVICE BV | The website offers a collection of over 10,000 artworks, including original paintings and graphic art. The artists featured on Artistworks are primarily Dutch artists, such as Karel Appel and Jan Cremer. Artistworks is owned by HILTERMANN ART SERVICE BV, a company with a long history in the sale of contemporary art. | Merchandise & Retail → Art Shops 59 | art 3856 artist 5745 collection 7566 | North-Holland → Amsterdam 41253 |
| beavangolen.nl | Bea van Golen Fotografie Kunst | Bea van Golen showcases her photography in various series, such as 'Image', 'Horizon', 'Landmark', and 'Reflections'. She has completed a project focusing on abandoned fields and their blossoming vegetation, with the location being the former Buitenschool square in Dordrecht. Bea van Golen also offers floral notes, which can be sold in museums via an automatic dispenser, and postcards for sale. | Painting → Oil Painting 326 | postcard 278 flowers 3248 photography 9503 | South-Holland → Dordrecht 4531 |
| bonniesepter.nl | Bonnie Septer | Bonnie Septer lives in Zwolle and began her work with mosaics as a workshop. She has developed her hobby into creating larger objects such as tables, mirrors, and boots. Bonnie Septer offers mosaics workshops and has exhibited her work in various institutions in Zwolle. | Painting → Acrylic Painting 547 | mosaic 213 tile 2869 photo 7778 workshop 19325 | Overijssel → Zwolle 7395 |
| brandeninhout.nl | BrandenInHout.nl | The website describes the process of wood burning, where wood is darkened with heat to create text and drawings. The website informs about the event 'Winter in the vesting', where the owner is present with Glasatelier Zwolle in Elburg. Wood burning is presented as an accessible art form that anyone can learn. | | wood burning 15 drawings 1329 text 2467 wood 4153 event 45199 | Gelderland → Elburg 846 |
| carliendubben.nl | Carlien Dubben | Carlien Dubben began drawing and illustrating at a young age. After completing her secondary education and studying philosophy, she attended an art academy and mastered various printing techniques, including woodcut, lithography, and etching. She has published her work in various magazines and books, and recently organized an exhibition in her Werkstätte. | Arts & Culture → Art Education 594 | woodcut 45 etching 48 graphics 123 drawings 1329 illustration 2447 | Westerwolde → Ter Apel 345 |
| catharinavanloenhout.nl | Catharina van Loenhout | Catharina van Loenhout (Toos van Agtmaal) was born in 1951 and has lived in Vlissingen since 1972. She has developed her creative interests, including drawing, painting, philosophy, and writing. Since 1985, she has dedicated herself to her art, having followed training courses in drawing, painting, art history, and graphic arts. | Painting → Oil Painting 326 | etchings 76 drawings 1329 art 3856 paintings 3907 | |
| cb-illustratie.nl | CB illustratie | The website features illustrations categorized into areas such as children’s books, inkwork, posters, and vector art. CB illustratie sells posters and designs for t-shirts and stickers through its webshop and Redbubble/Teepublic. The website also includes links to Instagram, where Christiaan shares his latest work and creative projects, and to Inkbox for temporary tattoos. | Painting → Digital Art 820 | tattoo 799 poster 837 illustration 2447 portfolio 6854 design 27202 | Friesland → Leeuwarden 6068 |
| cityscale.nl | Neve | The website sells 3D maps of cities, including Groningen and Zwolle, in various formats (Mega and Mini). The maps are designed with attention to detail and are intended as eye-catching pieces. The website is owned by Neve, a company registered with the KVK and with VAT number NL861062516B01. | | map 801 city 1875 | Overijssel → Zwolle 7395 |
| creativegift.nl | Creative Gift | The website offers house portraits primarily in watercolor, focusing on capturing memories of homes and families. Creative Gift also organizes house portrait workshops. The website includes information about the entrepreneur, a blog, contact details and general terms and conditions. | Painting → Watercolor 274 | house portrait 12 watercolor 369 gift 6442 | |
| cumber.nl | AIRBRUSH NL | The site prominently advertises various Paasche turbo airbrushes for sale, including the Super 63 and Super 63E models, as well as the Super 93E model. Alongside airbrush sales, the website offers airbrush parts, specifically those from the Devilbiss brand, for sale. The website lists shipping destinations worldwide, including Europe, the USA, Russia, Africa, Asia, and Australia. | Artists → Freelance Artists 25 | airbrush 52 part 5044 ship 5103 sale 5930 | North-Holland → Amsterdam 41253 |
| dertnijlandfinearts.nl | Kunst van Dert Nijland Fine Arts | The website offers a wide range of artworks, varying from oil and watercolor paintings to lithographs and posters. Works by various artists are showcased, including Banksy, Renso Tamse, Roy Lichtenstein, Andy Warhol, Keith Haring, and Pierre Alechinsky. In addition to paintings and graphic art, automobilia, such as reproductions and lithographs of cars, are also offered. | Collections & Antiques → Collections 177 Art Management & Sales → Art Dealers 112 | graphic art 89 paintings 3907 artist 5745 | |
| egarts.nl | Egarts Egarts | The design studio is led by Edward van Grol, a product designer based in the Netherlands. Currently, Edward van Grol works as a Senior UX-designer for the ABN AMRO app and undertakes various freelance projects. The studio’s work encompasses diverse projects including graphic design, product design, interactive design, and magazine layouts. | Multimedia → Interactive Media 40 | graphics 123 interaction 245 magazine 2182 design 27202 | |
| ellie-studio.nl | ELLIE Studio | The website sells various types of children's room wallpaper, such as patterned wallpaper and collage wallpaper, as well as personalized posters with themes like starry skies, animals, and flowers. ELLIE Studio also offers a selection of birth cards, handcrafted posters with poems, and moon phase posters, as well as various other decorative elements for baby and children’s rooms. The website offers the possibility to order personalized starry sky and birth posters and is specialized in creating a festive and imaginative atmosphere in children's rooms. | Interior → Wallpaper 1001 | birth card 69 childrens room 104 poster 837 wallpaper 1756 decoration 4085 design 27202 | |
| etsenshop.nl | Etsenshop | The website offers a selection of etchings from artists such as Corn. Brandenburg, H.E. Roodenburg, and W. Witsen. Etsenshop specializes in the acid-free making of etchings and offering etchings with passe-partout. The website also offers services for collecting and acid-free restoring of yellowed etchings, as well as framing etchings. | | etchings 76 frames 2556 | |
| fanniecoenen.nl | Fannie Coenen | Fannie Coenen introduces herself as the creator of the artworks featured on the website. Her work evolves continuously and encompasses various techniques and styles, with a focus on organic forms and a connection to nature. She repurposes old drawings and paintings into new artwork, which she then places on greeting cards for loved ones. She also offers courses and workshops. | Painting → Digital Art 820 | greeting card 335 drawings 1329 artwork 2248 nature 9094 course 14728 | |
| fotowonderland.nl | Fotowonderland | The website offers a wide range of personalized products, including stickers, invitations, Christmas decorations, and items for birthday parties and celebrations. Customers can have their own names, photos, and messages printed on the products, creating a unique and personal touch. The website describes positive customer experiences with the quality of the products, fast delivery, and excellent service from Anneke, the owner. | Gifts → Baby Gifts 473 | lantern 77 invitation 204 mug 280 stickers 777 gift 6442 | Maashorst → Uden 1540 |
| gerdableeksma.nl | De Neus Producties | The etching process involves creating a drawing on zinc, immersing it in nitric acid, filling it with ink, and printing it on etching paper. After printing, the etchings are colored with watercolor and finished with a black passe-partout in an aluminum frame. The website contains information about the artist Gerda Bleeksma, her contact details, company information and KvK (business registry) details. | Art Management & Sales → Art Dealers 112 Home → Antiques & Collectibles 1523 | passe-partout 50 etchings 76 watercolor 369 frame 883 print 5511 | Dijk en Waard → Broek op Langedijk 243 |
| gerdajonker.nl | Gerda Jonker | Gerda Jonker identifies four elements – earth, water, air, and fire – as the foundation of existence and describes the forces that hold these elements together, such as gravity and ethereal forces. Her artwork aims to capture the organic world and connect visible and invisible worlds, the earthly and the otherworldly. Leo Peijs writes that her approach is focused on creating ‘growth images’ and representing human development from black and white to a unique color. | Painting → Contemporary Art 805 | element 234 world 321 art 3856 | |
| hugotekstra.nl | Hugo Tekstra | Hugo Tekstra is a Dutch artist based in Leeuwarden who creates art incorporating collage, silkscreen, and photography, emphasizing the importance of the creative process in his work. Tekstra's artistic approach involves embracing imperfections and decay during his work, allowing elements like dripping paint and peeling tape to become integral to his visual language. He frequently utilizes walks in cities as a starting point for his projects, collecting materials like books, records, and photographs to inform his subsequent studio work and narrative construction. | Painting → Contemporary Art 805 | collage 262 walk 2161 photography 9503 | Friesland → Leeuwarden 6068 |
| ikwileenmuurschildering.nl | Jacq Design | The website features a portfolio of Jacq Design's work, including wall paintings for children's rooms, living rooms, and businesses, as well as portraits and paintings. Visitors can contact Jacqueline for advice and a free consultation to have a custom wall painting designed, considering their wishes and interior style. The website describes the creative process, from gathering ideas to creating a design and providing a price estimate. | Painting → Murals 125 | interior style 25 wall painting 32 idea 2367 portrait 3685 paint 8747 design 27202 | Krimpenerwaard → Ouderkerk aan den IJssel 145 |
| ink-artcompany.nl | Ink & Art Company | Lilian Dekkers is a tattoo artist with over 10 years of experience creating unique and personalized tattoos in various styles. Her specialty lies in photo-realistic and portrait tattoos, where she designs all her own designs to guarantee a unique tattoo. INK & Art Company is a shop where tattoo merging with art comes together. The website offers information, general terms and conditions, privacy statements, and cookie policies, as well as reviews and contact information. | Tattoo & Piercing → Tattoo Studios 202 | tattoo 799 portrait 3685 design 27202 | |
| interiorsigns.nl | Interiorsigns | The website specializes in designing and producing luxury wall decor using laser engraving and woodworking techniques, such as company logos, MOS letters, and PET-felt letters. Customers can choose from various materials such as oak, black MDF, and rendiermos, and different sizes and designs, including world maps and city maps. Interiorsigns offers custom solutions and can create designs based on the customer's wishes. Furthermore, general terms and conditions, privacy policies, and a return policy are provided. | Decor & Furnishings → Wall Decor 1035 | company logo 20 letter 834 panel 868 wood 4153 logo 4660 design 27202 | Dinkelland → Denekamp 375 |
| irisisbuiten.nl | Iris de Boer | The website features Iris’s illustrations, which are inspired by nature. Iris offers custom birthday cards and postcards, based on her own illustrations or custom drawings. She also provides murals for various locations and is open to collaborations and selling postcards to retailers. | Visual Arts → Printmaking 302 | postcard 278 mural 338 illustration 2447 collaboration 16036 | |
| jeanetjaaltink.nl | Jeanet Jaaltink | Jeanet Jaaltink's artistic portfolio comprises enigmatic, playful, endearing, and melancholic images, blending fantasy and reality. The artist utilizes various techniques, both on paper and canvas, and draws inspiration from images and photographs. Copyright © 2025 | Jeanet Jaaltink | Visual Arts → Printmaking 302 | mixed media 104 animal 2908 paintings 3907 inspiration 4081 | |
| keesversloot.nl | Kees Versloot | Kees Versloot offers a wide range of services including art design, fine art printing, web design, and photography. The website displays examples of work including paintings, drawings, and photography. The print service focuses on art, illustrations and photos, with a maximum size of A1 and limited runs (1-20 copies). | Sculpture → Visual Arts 4165 | illustration 2447 project management 3423 art 3856 webdesign 4092 print 5511 design 27202 | |
| kunstblijft.nl | Kunst Blijft | The gallery focuses on the art of Aat A. van Dijk, a graphic artist and artist who lived a simple life and primarily spent his money on art supplies. After his death, the gallery aims to give Aat's creations a new home, ensuring his work will be appreciated for years to come. The artist's style is influenced by nature and the stories behind the subjects, employing techniques such as watercolor, collage, screen printing, etching, and paintings. | Galleries → Online Galleries 225 | collage 262 watercolor 369 attention 570 art 3856 paintings 3907 nature 9094 | |
| kunstenkirs.nl | kunst_en_kirs | The website showcases a portfolio featuring hand-drawn cards, illustrative posters, and storybooks. The artist offers commissions for designing and producing cards and pouches. A storybook project, 'Vivi Vliegt,' is currently being developed with the artist's mother, who writes the text and the artist creates the illustrations. | Books → Children’s Books 1042 | storybook 16 pouch 68 poster 837 card 1975 illustration 2447 design 27202 | |
| leniewijnen.nl | Lenie Wijnen | Lenie Wijnen began painting after her friends gifted her the necessary supplies and encouraged her to take her hobby seriously. She attended a painting course with Mia Westerhof to learn the basics and gain further inspiration. In addition to painting, she designed album covers for her partner, René Montfoort (Romerium). | Painting → Contemporary Painting 452 | acrylic paint 204 cover 392 canvas 694 paintings 3907 inspiration 4081 course 14728 | |
| leonvanwijk.nl | Leon van Wijk | Leon van Wijk is an artist born in 1987 who creates his work by exploring the interactions between people, cultures, and everyday objects. His portraits are complex and can be interpreted in multiple ways, with multiple layers and emotions. The website displays a selection of his works, including acrylic paintings on wood and canvas, and offers sales of prints via direct messages. | Social & Events → Event Entertainment 92 | interaction 245 character 449 portrait 3685 color 4159 print 5511 paint 8747 | North-Holland → Oostzaan 362 |
| louisderijks.nl | Louis Derijks | Louis Derijks evolved over more than 50 years from figurative to abstract art, while always retaining recognizable elements. His works utilize diverse materials, including sawdust, rope, gold paint, and handmade paper. His paintings, especially recent works, are peaceful and display natural tones and sometimes religious or meditation-related themes, such as influences from Byzantine churches and the ‘T-bar’ that resembles a tunic. | Painting → Contemporary Art 805 | graphics 123 paper 770 text 2467 architecture 3223 paintings 3907 | |
| maasdorpen.nl | Maasdorpen | The website offers various services including printing, poster production, folding techniques, and printable products. The company also offers translations into German and media placements in German media. The weekly edition of 'De Maasdorpen' and 'Het St. Andreasklokje' is distributed weekly with an edition of approximately 2,770 copies. | Local Media → Newspapers 143 | edition 157 poster 837 translation 1523 advertisement 1707 print 5511 | Horst aan de Maas → Meerlo 53 |
| marie-louisebrantjes.nl | Marie-Louise Brantjes | Marie-Louise Brantjes studied interaction design at the TU Delft. She subsequently worked as an R&D engineer at Allseas, focusing on the interaction between humans and machines on offshore pipe-laying vessels. In her free time, she enjoys sailing on traditional fishing boats from the Zuiderzee and creates drawings, paintings, and graphic designs. | Painting → Oil Painting 326 | zuiderzee 10 interaction 245 drawings 1329 graphic design 2042 paintings 3907 artist 5745 | |
| mariekeberghuis.nl | Marieke Berghuis | The website features several of her paintings from 2017, including titles like "Competing Flowers", "During her lifetime", "Untitled", and "The Positive ‘No’", each accompanied by details about the medium and dimensions. A significant portion of her artistic output was initially known only to her close circle during her lifetime. The site highlights this, while also displaying the works themselves. Additionally, the website describes an artist publication/mini comic titled ‘BRAIN FLOWER EURO/SNOW IN LOVE’ which is also the name of a font and scented candle, referencing her broader creative pursuits. | Books → Publishers 1040 | comic 59 font 71 candle 792 publication 2018 artwork 2248 paint 8747 | |
| marlienkeramiek.nl | Marlien Keramiek | The website provides details about boetseer clubs for both adults and children and teenagers. Ceramic workshops are offered, and information is provided about birthday parties for young people (8-16 years). In addition to workshops and clubs, the owner’s own ceramic work is presented and potentially available for order. | Family Fun → Children’s Activities 1906 | email 1012 work 3122 party 5928 child 11566 workshop 19325 | Gelderland → Arnhem 8680 |
| martienopdenvelde.nl | Martien Op den Velde | Martien Op den Velde is a graphic artist who graduated from the Utrecht Academy of Fine Arts in 1961. The website provides an overview of his works, including collages, Iers muurtjes (Irish walls), Noorse impressies (Norwegian impressions), and studies of sunsets, as well as works with handwriting and landscapes. Martien Op den Velde describes his artistic process as a craft-based approach focused on creating surprising and layered images using various printing techniques. | Painting → Abstract Painting 594 | graphic art 89 collage 262 study 720 color 4159 studio 5465 | |
| martyntattoos.nl | Martyn Tattoos | The studio specializes in styles such as black and grey realism/semi-realism/chicano and portraits. Martyn, the owner, is an experienced tattoo artist with a background in drawing and graffiti, and has completed a training apprenticeship under Jay Freestyle. The process begins with a meeting, where Martyn offers a cup of coffee and discusses the design together, to ensure the final result meets the customer’s wishes. | Tattoo & Piercing → Tattoo Studios 202 | tattoo 799 studio 5465 appointment 13510 design 27202 | Flevoland → Almere 7765 |
| meubelmakersarnhem.nl | Meubelmakers Arnhem Co√∂peratie U.A. | The company has been jointly executing interior design and construction projects for the business and cultural sectors since 2016. In addition to business projects, they also create custom kitchens, tables, cabinets, and other furniture for private individuals. The website also introduces the individual makers Peter Roefs and Jeroen Verduijn, with their own companies and expertise. | Visual Arts → Museums 2049 Finishing & Trades → Interior Construction 502 | private individuals 13 kitchen 6443 interior 8093 furniture 8751 | Gelderland → Arnhem 8680 |
| michielvannieuwland.nl | Michiel van Nieuwland | The process of creating a linotableau involves combining loose sheets after each print and rethinking the further approach. Michiel van Nieuwland combines a high degree of craftsmanship with the surprising technique of the printing process. The artworks are characterized by a tight geometric pattern that serves as a compass for the artistic journey. | Woodworking → Wood Carving 139 | pattern 2012 | |
| moniquethijssen.nl | Monique Thijssen | Monique Thijssen’s work is based on the influences of Byzantine and Ottoman art and architecture, especially her inspiration from Istanbul. Her paintings and graphic work are strongly influenced by buildings such as the Hagia Sophia, the Blue Mosque, and the Topkapi Palace in Istanbul. Monique Thijssen uses primarily acrylic paint to create colorful and rich works with her own color palette. | Painting → Genres 14 | istanbul 26 graphic art 89 acrylic paint 204 paintings 3907 | |
| montagnarde.nl | C.A.M. Bergman | The website provides an overview of the paintings and drawings made by Kees Bergman. Kees Bergman describes the origin of the name 'Montagnarde' as a French translation of his surname. The website illustrates Kees Bergman’s personal passion for drawing and painting, which began in elementary school and was further developed through courses and education. | Painting → Contemporary Art 805 | ink 199 acrylic paint 204 drawings 1329 paintings 3907 course 14728 | |
| mowiththeflow.nl | MOwiththeflow | The artist creates drawings of various sizes, from small greeting cards to large murals, with attention to detail. The website offers a portfolio of the artist, as well as information about the services offered, such as house portraits and murals. The artist often uses black lines with accents of color and can emphasize depth and detail in portraits. He also makes recycle art objects. | Painting → Murals 125 | mural 338 poster 837 card 1975 portrait 3685 color 4159 | Gelderland → Nijkerk 3608 |
| ock-netwerk.nl | OCK | OCK, short for Vereniging Overleg Cultuurparticipatie en Kunsteducatie Noord-Holland, is affiliated with 26 centers for the arts, theater, music, and art schools throughout North Holland. The association focuses on exchanging knowledge and experiences, particularly regarding developments and trends in the sector, and supports the affiliated organizations in employer matters and the development of new forms of working, such as during the coronavirus period. OCK facilitates meetings, visits, and thematic gatherings, aimed at both directors and employees of the organizations and affiliated freelancers. | Arts → Artistic Training 113 | knowledge 3528 culture 3922 education 13471 collaboration 16036 | Opmeer → Hoogwoud 149 |
| peetmade.nl | PeetMade | The website showcases portfolios of various projects, including wall and portrait paintings, lettering of monuments, and wallpaper and painting jobs. PeetMade provides solutions for both private and business clients, ranging from small to large jobs, both indoor and outdoor. The company specializes in creating rubber-cut molds for second inscriptions on shelves. | Decor & Furnishings → Wall Decor 1035 | shelf 87 letter 834 wallpaper 1756 paint 8747 | |
| peterdrenthgrafiek.nl | Peter Drenth | The website presents the graphic work of the graphic artist Peter Drenth, who was born in 1947 in The Hague and graduated with honors from the KABK in Groningen. Peter Drenth's work has been exhibited in various locations, including Singer Laren, Slot Zeist, and embassies. Drenth's work can be ordered via the contact page, with the option of delivery with or without an aluminum frame. | Galleries → Individual Galleries 51 | gallery 1983 work 3122 | Zeist → Slotplein 20 |
| pierrejetten.nl | Pierre Jetten | Following a career as a dentist, Pierre Jetten dedicated himself to creating graphic art in 2005, primarily focusing on etching, woodcuts, and linocuts. He attended classes in graphic arts and completed the free graphics specialization at the art academy in Maasmechelen and is currently involved in the Artimosa Art Circle. His work has been exhibited in the Netherlands, Belgium, Germany, Canada, and the US, and he periodically participates in art markets. | Visual Arts → Printmaking 302 | linocut 31 printmaking 40 woodcut 45 etching 48 exhibition 5332 artist 5745 | Beesel → Reuver 251 |
| plattegrondzaken.nl | Plattegrondzaken | The website describes Plattegrondzaken as the number 1 specialist in maps for the recreation industry, with over 300 already drawn maps. Plattegrondzaken offers maps in the client's brand style, which are flexible and adaptable and stored in an online library for easy updates. The website shows examples of maps for various locations, including campsites, holiday parks, bush camps, and parks by the coast, with information about their location and amenities. | Vacations → Bungalow Vacations 168 | brand style 276 holiday park 566 map 801 signage 838 campsite 2093 | Tholen → Scherpenisse 58 |
| popphoto.nl | Pop Photo Fotografie | The website showcases a portfolio of photos taken with a restored Canon AE-1 camera and 35mm-film from the Hema. The website describes the purchase and use of a scanner to scan films. The website indicates that more videos will be published in the future. | Websites → Portfolio Pages 15 | scanner 175 film 3007 video 6714 portfolio 6854 photography 9503 | Overijssel → Zwolle 7395 |
| poppylicious.nl | Poppylicious | The website sells various types of cards, such as birthday cards, seasonal cards, and cards with different messages, like ‘Wanna go for...?’. It also offers posters in various sizes, including A4, A3, and 50x70 cm, with both standard and custom options. The website provides shipping options with different rates, depending on the weight and value of the order. Furthermore, there are important information pages such as privacy policy and general terms and conditions. | Occasions & Gifts → Occasions 31 | christmas card 58 poster 837 customization 1723 card 1975 ship 5103 | |
| prentenwinkel.nl | Prentenwinkel | The shop specializes in scientific and historical prints, 3D models and illustrations, offering a wide range of themes including anatomy, botany, zoology, and art. The prints were created using traditional techniques such as lithography, wood engraving, copper engraving and steel engraving, with each element engraved on a separate stone. The website provides an overview of various categories, including flowers, animals, artists (Chagall, Miro), calendars, and historical decorative objects. | Visual Arts → Printmaking 302 | anatomy 70 stone 724 print 5511 artist 5745 | |
| quintusvanmastrigt.nl | Quintus van Mastrigt | The website contains a collection of artworks, including acrylic on canvas, graphic art, monoprints, and drawings. Projects such as 'kunst10daagse bergen 2024' and 'buitenkunst 2018' are highlighted. The site also includes information about activities in the film, archive and photography fields, as well as workshops. | Visual Arts → Printmaking 302 | graphic art 89 sculpture 1440 artwork 2248 photography 9503 installation 13742 | Alkmaar → Oudorp 345 |
| robeikenaar.nl | Rob Eikenaar | Rob Eikenaar offers drawing and illustration workshops to various groups. The workshops are designed to help participants visually realize their own stories, often with a pleasantly surprising outcome. The website provides information on workshop duration, costs (including material costs and travel expenses). | Arts & Culture → Art Education 594 | creative 539 audience 901 drawing 1101 illustration 2447 story 8285 workshop 19325 | |
| roberthuiberts.nl | Robert Huiberts Photographics | Robert Huiberts has been fascinated by photography since childhood and chose a graphic design profession. The website features a portfolio of his photography (portrait, nature, etc.) and graphic designs (graphic design, digital publishing). In addition to his artistic activities, Robert Huiberts offers workshops, particularly focused on patisserie (Valentine's bonbons) and photography (iPhone photography). He also organizes regular exhibitions and trade fairs. | Gifts → Gift Cards 981 Art & Culture → Art Events 327 | patisserie 38 graphic design 2042 exhibition 5332 photography 9503 | The Hague → Loosduinen 395 |
| ronnevandenhurk.nl | Ronne van den Hurk | Ronne van den Hurk exhibits her work, including paintings and woodcuts, in various locations, including the final exam exhibition of the Classical Academy Groningen and the Heileuver Painting House in Dalmsholte (Ommen). Currently, she is exhibiting at the Heileuver Painting House in Dalmsholte (Ommen) until September 9, 2024, where she presents stone prints, woodcuts, and etchings. Visitors can view her work in an online gallery, ViaVia31, and find her on Fridays and by appointment. | Painting → Contemporary Painting 452 | woodcut 45 etching 48 gallery 1983 paintings 3907 exhibition 5332 | Overijssel → Ommen 1095 |
| sabine-design.nl | Sabine Design | The website introduces Sabine Design as a service provider that creates custom illustrations on request. Illustrations are delivered as digital PNG files with high resolution (300 DPI) for editing. The website highlights Sabine Design's accessible pricing and encourages visitors to contact her for a non-binding consultation. | Visual Arts → Fine Art 322 | greeting card 335 watercolor 369 illustration 2447 logo 4660 | |
| seeftex.nl | SEEFTEX | The website provides a wide range of services, such as marketing, printing, business clothing, online design, promotional items, and signage. SEEFTEX emphasizes the value of teamwork and customer involvement, actively involving clients in the creative processes. With over 10 years of experience, the company strives to help businesses strengthen their market position through customized marketing campaigns and quality products. | Clothing → Workwear 1001 Manufacturing & Industrial → Business Clothing 20 | business clothing 24 promotional items 251 signage 838 print 5511 marketing 7107 design 27202 | |
| signdsign.nl | Sign Design | The company specializes in providing various signage and film services, such as facade, window, and car lettering, thermal and security films, interior films, stickers, and printing. The website contains a portfolio with project photos and information about specific services, such as billboards, signage, tension fabric frames, and lightboxes. Sign Design also offers printing services, such as business cards, envelopes and stationery, and specializes in supplying safety films for various applications. | | lightbox 14 billboard 44 signage 838 film 3007 print 5511 | |
| skomiart.nl | SkomiArt | The webshop was established based on the owners’ experience in interior styling and their passion for beautiful decoration. SkomiArt provides a platform for European artists to sell their acrylic paintings. Visitors can view and purchase paintings, and make appointments to view them in the store. | Painting → Acrylic Painting 547 | acrylic paint 204 decor 945 paintings 3907 artist 5745 | |
| smallmercies.nl | Small Mercies | Hanneke Bennett provides a wide range of services, from graphic design and ceramics to PR and exhibitions. She works as secretary to the exam board and other projects at ArtEZ Hogeschool voor de Kunsten, and runs Small Mercies where she produces ceramics and graphic art. The website displays a portfolio of digital works, prints and graphic designs, and offers the possibility to purchase her work directly through Etsy and OpenSea. | | nfts 26 pr 189 ceramics 1271 graphic design 2042 exhibition 5332 education 13471 | |
| stijnseip.nl | Stijn Seip | Stijn Seip’s studio located at Nieuwendammerdijk 301 in Amsterdam is open to the public on Sundays from 13.00 to 18.00 hours, from April to the end of October. Her work is inspired by the surroundings of the Nieuwendammerdijk, ranging from figurative to abstract paintings, with particular emphasis on the changing light conditions and the diverse facades of the houses. In addition to paintings, the studio also offers art gifts, including a birthday calendar with drawings of villages in Tuscany and a card game designed by astronomer Simon Portegies Zwart to celebrate the inauguration of the MoDeSta computer. | | tuscany 70 graphic art 89 paintings 3907 studio 5465 travel 7210 | Amsterdam → North 657 |
| studionickvanoosten.nl | Studio Nick van Oosten | Nick van Oosten has created illustrations for a diverse range of projects, including Autodrop chocolate bars, La Place Rooibos tea, Queen Bee beer brand, and Jumbo canned goods, as well as visuals for organizations like T.N.O.. The portfolio includes illustrations for brands such as Jan van Gent, Chiquita, Hooghoudt, Brouwerij Hope, and Rabobank. The website also features sketches, character designs, and infographics for projects like the logo for the Stripmuseum-winkel and Museum Meermanno Baron van Westrenen, as well as various marketing campaigns. | Architecture & Design → Creative Industries 1157 | visuals 207 sketch 271 character 449 illustration 2447 portfolio 6854 | South-Holland → Dordrecht 4531 |
| technicalprintsolutions.nl | Technical Print Solutions | The company offers screen printing and object printing, with expertise in printing various metals and plastics. The website describes the benefits of on-site printing, such as avoiding transportation costs and damage, and the possibilities of printing large batches and objects on-site. Technical Print Solutions emphasizes their experience in the graphics industry and their control of the entire printing process, resulting in durable and scratch-resistant prints on even rough surfaces. | Plastics → Manufacturing 7708 Digital Design & Graphics → Graphics 88 | screen printing 128 quote 12863 | |
| theresevaneldert.nl | theresevaneldert.nl | Thérèse van Eldert utilizes various techniques and materials in her artwork, resulting in paintings in mixed media on canvas and works on paper, wood and metal, collages and assemblages. Her work often incorporates ‘objets trouvés’ collected during her travels, combined with fragments of ancient texts and other materials such as paper types, flowers, and metal. The artist’s work is inspired by her travels, particularly to countries such as Yemen, Libya, Morocco, Tunisia, Syria, Egypt, India, Mexico and Europe, and she emphasizes observing and depicting the world. | Visual Arts → Collage 114 | assemblage 29 canvas 694 paper 770 travel 7210 | North-Holland → Amsterdam 41253 |
| tomaslaar.nl | Studio Tomas Laar | Tomas Laar describes himself as an independent graphic designer with a passion for typography, identity design, and custom lettering. He combines traditional graphic design principles with custom lettering techniques to create distinctive brand identities for his clients. The website features a selection of projects, including self-initiated work, commissioned projects, and work created at Pony. | Graphic Design & Printing → Typography 82 | typography 155 letter 834 design 27202 | |
| uitgaasterland.nl | Út Gaasterlân | The website offers an online shop with postcards, posters, prints, and hand-printed textiles. Hand-printed textiles are produced with stories and images from Gaasterland using handmade stamps, making each product unique and sustainable. The website offers custom solutions, such as Friesian birth certificates and custom artwork prints, and provides information about sales points in Balk and Oudemirdum, as well as its presence at various markets. | | postcard 278 textile 1421 market 2772 print 5511 | Netherlands → Friesland 27911 |
| vanschietekententekst.nl | Studio Klaproos | The website features a shop with a variety of greeting cards, including series such as 'Lief & Leuk', cards with forest animals, angels, dinosaurs, and Christmas cards. In addition to cards, Studio Klaproos also sells card holders, linen bags, and posters featuring dinosaur designs. Furthermore, the website offers custom graphic designs, such as buildings, portraits, and illustrations for children's books, as well as text editing services. | Graphic Design → Cards 442 | children's books 83 greeting card 335 poster 837 graphic design 2042 | |
| varishavos.nl | Varisha | The website presents various categories of art and clothing, including paintings, portraits, and buildings. Customers have the option to place orders, have them delivered, or pick them up themselves. The website also includes a contact form, FAQ, and links to social media such as Facebook and Instagram. | Consumer & Lifestyle → Ethical Fashion 11 | sweater 413 buildings 898 portrait 3685 paintings 3907 order 6912 | |
| verhalenvangers.nl | VerhalenVanger | The website offers specialized services for creating custom artworks, including glass portraits, birth announcements, and custom portrait drawings. The artworks are designed with a minimalist aesthetic and a warm style, based on a personal and thoughtful approach stemming from a background as a psychologist. VerhalenVangers focuses on capturing the essence of life stories and translating them into visual and textual artworks, suitable for special occasions. | Commerce → Greeting Cards 430 | birth announcement 73 artwork 2248 glass 2919 portrait 3685 gift 6442 story 8285 | |
| weldesign.nl | WelDesign | WelDesign provides a wide range of graphic designs, including flyers, logos, and branding guidelines. The website also offers information about creative workshops and painting courses provided by the owner, catering to both children and adults. WelDesign has an address in Alphen aan den Rijn and is registered with the KvK (Dutch Chamber of Commerce) with the number 57240183. | | brochure 1642 graphic design 2042 artwork 2248 branding 4614 paint 8747 workshop 19325 | South-Holland → Alphen aan den Rijn 3978 |
| werkplaats-w.nl | Werkplaats W | Wouter Gresnigt graduated from the art academy in Den Bosch in 1999. His work can be found in newspapers, magazines, and on chalkboards. He has also illustrated children's books and publishes his own illustrated stories. | Literature → Dutch Literature 292 | art academy 19 children's books 83 illustrator 105 graphic design 2042 work 3122 | North-Brabant → 's-Hertogenbosch 8868 |
| willemhartgers.nl | Willem Hartgers Freelance Grafisch Vormgever Multimedia Specialist | The website features a portfolio showcasing Willem Hartgers’ graphic designs and artwork. An online shop, ‘EH PAINTINGARTS’, offers original artwork by Evert Hartgers, as well as reproductions. The website provides the option to purchase reproductions of previously created projects and is designed as an example of a cost-effective and customizable website, with quick links to various artist selections, reproductions, and legal documents. | Websites → Examples 38 | reproduction 60 online shop 1310 graphic design 2042 artwork 2248 portfolio 6854 | |
| zitauiterwijk.nl | Zita Uiterwijk | Zita Uiterwijk describes her artistic process as a search for her own visual language and the essence behind the visible world, often using abstract elements and limited color usage. Her work is based on figurative principles, but also contains abstract elements originating from observation and association with music and rhythm. In her portraits, she focuses on representing the inner essence and hidden history of the person being portrayed. | Visual Arts → Printmaking 302 | visual language 54 graphic art 89 textile 1421 portrait 3685 music 13170 | |
| power2change.nl | Power2Change | With a compelling, well-designed brand identity, the company shows who it is and what it stands for. A professional logo design or a complete brand identity creates trust in the company, its products, or its services. A powerful brand identity design increases the recognizability of the company. | Design → Graphic Design 2433 | brand identity 1457 logo 4660 design 27202 | |
| drtaylor.nl | D.R. Taylor | The website features artwork associated with different projects and labels, including Gallery Six, Italdred Records, and Handbook. D.R. Taylor often collaborates with other artists, such as Hidekazu Imashige and EiramsAccord, and utilizes techniques like a ‘flower press’ in his work. The website highlights an interest in observing animals in nature, with the wonder of a child at its core. | Crafts → Floral Design 241 | artworks 460 animal 2908 | |
| litholab.nl | Litho Lab Langerak | Marius Langerak is a printmaker, lithographer, and workshop specialist focusing on stone lithography, affiliated with Academie Minerva in Groningen. The website showcases his work, including prints for sale and exhibitions, and provides information about printmaking techniques. Beyond his primary artistic practice, the site also features links to his Soundcloud, Tumblr, and other social media platforms, as well as historical information about the origins of lithography. | Visual Arts → Printmaking 302 | lithography 25 exhibition 5332 print 5511 workshop 19325 | |
| pragtdesign.nl | Pragt Design | The website introduces Pragt Design as a brand dedicated to visual art created by Marie-Hélène Pragt, particularly over the past five years. The portfolio displays examples of various designs, including company logos, websites, business cards, letterheads, and posters, demonstrating her artistic talent. Marie-Hélène Pragt has evolved from a graphic designer to an artist utilizing diverse media, such as photography and painting, in her creative work. | Sculpture → Visual Arts 4165 | art 3856 logo 4660 paint 8747 photography 9503 design 27202 | |
| architatts.nl | Architatts | Tattoo Studio Architatts emphasizes professionalism, reliability, and hygiene within its studio. The studio values exclusivity to ensure a personal and individual approach to clients. Tattoo Studio Architatts is located in the center of Breda and can be reached via phone and email. | Tattoo & Piercing → Tattoo Studios 202 | exclusivity 11 professionalism 33 tattoo 799 studio 5465 | North-Brabant → Breda 9003 |
| hesterdrolinga.nl | Boks Webdesign | The website contains a portfolio with various subcategories, including pastel pencils and chalk, sketches, interior design, and school assignments. Hester Drolinga describes her interest in interior design as a long-term dream. The website also includes a motivation letter for the Vormgeving education program. | | interior design 1802 portfolio 6854 | |
| andydavies.nl | Vintage Tattoo Studio | Andy Davies is a professional artist specializing in custom tattoos, ranging from realistic to oriental styles, and including backpieces and smaller designs. He currently operates Vintage Tattoo Studio in Breda, Netherlands, and his work has been featured by notable figures such as Sharon Kovacs, Duncan Laurens, and Itamar Zechoval. The studio is located at Baliendijk 40, 4816GE Breda, and is open Tuesday to Saturday from 10:00 to 17:00. | Visual Arts → Tattoo Art 32 | illustrator 105 tattoo 799 studio 5465 paint 8747 | North-Brabant → Breda 9003 |
| 2902.nl | 2902 Reclame | 2902 Reclame provides high-quality services in lettering, including signage and car lettering. The website offers Wall Art, where photos come to life using CrystalClear Acrylic, and can also cover entire walls. 2902 has experience in projects such as signage, car lettering and in-store projects, and offers advice and designs for various projects. | Decor & Furnishings → Wall Decor 1035 | wall art 46 letter 834 | |
| lisannetekent.nl | Lisanne Mesa | Lisanne Mesa is an illustrator specializing in creating murals and drawings on windows and walls. She offers her services for various locations, including homes, offices, and restaurants, and can work with themes, illustrations, or logos. Lisanne Mesa resides in Volendam and operates under the business name Mesa design. | Context 161394 | mural 338 drawing 1101 logo 4660 interior 8093 | |
| soax.nl | Studio Soax | Studio Soax transforms client wishes into lasting images, from living room walls to company walls and various other objects. The artist uses different techniques, such as graffiti, wall paintings with ink and paint, action painting, and stencil art. Studio Soax offers workshops for schools, groups, special education institutions, and company outings, with a focus on creativity and education. | Public & Street Art → Street Art 163 | wall paintings 18 graffiti 243 canvas 694 wall 1378 atelier 1417 workshop 19325 | North-Brabant → Helmond 3058 |
| pentura-nummer-schilderen.nl | PENTURA | The website features a user-friendly interface with categories like ADULTS, ANIMALS, FLOWERS, KIDS, LANDSCAPES, and VEHICLES, allowing customers to easily browse and purchase art supplies. Customers can purchase Paint by Number kits, create their own designs on canvas, and explore products from brands such as Van Gogh, Bob Ross, and Schmincke. The site includes customer testimonials highlighting the quality of the theme, its ease of use, and excellent support offered by the Journal theme developer. | Arts → Art Supplies & Materials 241 | canvas 694 theme 4015 design 27202 | |
| kellylakeman.nl | Studio Kelly Lakeman | Kelly Lakeman is a graphic designer with extensive experience specializing in logo design, branding, magazines, books, and digital media. The website provides access to online portfolios, divided into print, digital, and book portfolios. Kelly Lakeman describes herself as an enthusiastic designer working as a freelance graphic designer since 2016, emphasizing her attention to detail and originality. | Design → Graphic Design 2433 | magazine 2182 branding 4614 logo 4660 portfolio 6854 book 11396 design 27202 | |
| lisannerijk.nl | Lisanne Rijk | The website contains a selection of recent works by Lisanne Rijk, including paintings and graphic designs. Visitors can find more information about past exhibitions and upcoming exhibitions of the artist. Lisanne Rijk is a graphic designer and artist who uses her creativity to translate ideas into visual concepts and stories. | Crafts → Textiles 1280 | graphic design 2042 idea 2367 paintings 3907 exhibition 5332 story 8285 | |
| ankiedevries.nl | Ankie de Vries | Ankie de Vries is an artist who primarily creates symbolic paintings. Her work also includes landscapes and seascapes. The website offers a glimpse into her creative process, where relationships, faith, and emotional value play a crucial role. | Painting → Contemporary Painting 452 | symbolism 97 landscape 2609 paintings 3907 | |
| withloveartprints.nl | WithLoveArtprints.nl | The website was founded by Wil Oortgijs, a freelance art director and designer who also does free work. The prints are inspired by nature, with a focus on details such as flora, fauna, and light. The prints are manually checked, signed, and numbered and are available in various sizes, ideal as a gift or for personal use. | Visual Arts → Printmaking 302 | paper 770 image 2605 print 5511 nature 9094 | |
| marcelart.nl | Marcel de Boer | Visitors can order a portrait drawing from their photo, with the artist assessing the photo's suitability for a drawing. Upon approval of the digital proof, the artwork is printed on high-quality paper, framed in an aluminum frame, and shipped to the customer's address. The website offers the possibility to order multiple prints in various formats. | Visual Arts → Drawing 1046 | paper 770 frame 883 artwork 2248 portrait 3685 photo 7778 | |
| studiogallery.nl | StudioGallery | The gallery, based in Amsterdam, offers a diverse collection of artworks by both established and emerging artists, showcasing the evolution of graffiti from the 1980s and 90s. They curate authentic street art and graffiti pieces, aiming to capture the energy and attitude of the streets in collectible works. StudioGallery provides art lovers and collectors with experiences and offers a variety of artworks available for purchase, including prints and original pieces by artists like Jason Revok, Ces53, Shepard Fairey, and Zedz. | Public & Street Art → Street Art 163 | art prints 22 street art 81 graffiti 243 paintings 3907 artist 5745 | North-Holland → Amsterdam 41253 |
| annemiekekooper.nl | Anne Mieke Kooper | Anne Mieke Kooper describes her creative process as a journey of discovery, exploring structures and color through experimentation. Her work includes both large and small series of weavings, often in combination with traditional and new materials, and she strives to create a third dimension in weavings. Kooper utilizes the elements of shorthand, codescript, and handwriting in her work and experiments with reusing threads from old fabrics to create unique color combinations and patterns. | Textile Arts → Crafts 9117 | weave 118 miniatures 163 structure 1305 textile 1421 color 4159 | North-Holland → Amsterdam 41253 |
| dubbelmreclame.nl | Reclamestudio – Dubbel M – Reclame | The studio offers advertising advice and helps with effectively presenting a company message to be found. Reclamestudio – Dubbel M – Reclame provides a wide range of services, including printing, design, web design, home styling, and bookbinding. The studio is located in Lelystad and offers a free quote based on the customer's needs. | Culture → Cultural Industries 24 | bookbinding 45 advertising 2302 webdesign 4092 print 5511 quote 12863 design 27202 | Flevoland → Lelystad 3180 |
| wimcrouwelinstitute.nl | Stichting Wim Crouwel Instituut | The institute believes that the connection between past, present, and future in graphic design is often underemphasized. It provides archive mediation, supports research, and offers university education, and organizes lectures and discussions to promote a deeper understanding of the role of the profession. The foundation was established in 2013 and is located in Amsterdam. | Personal Services → Memories 103 | past 119 future 404 graphic design 2042 archive 2067 research 8967 design 27202 | North-Holland → Amsterdam 41253 |
| muurbymas.nl | Muur by Mas | The website features a variety of wall paintings, including wall paintings, wall drawings, and office illustrations. Muur by Mas specializes in creating personalized wall decorations that match the customer's wishes, with options for children's rooms, companies, and living rooms. The website provides a contact form for inquiries and information on rates and possibilities. | Communication → Visual Communication 409 | wall painting 32 illustration 2447 | Overijssel → Zwolle 7395 |
| mooivanes.nl | Mooi van Es | Esther offers her creative work, specifically handlettering, for individual commissions. She describes her passion for creating unique and beautifully found artworks, and the satisfaction she experiences in translating ideas into tangible objects. In addition to handlettering, she shares her hobbies in crocheting and drawing, and shares her motto that beautiful things will come at their own time. | Crafts → Crochet 378 | handlettering 45 crochet 135 drawing 1101 artwork 2248 idea 2367 | |
| jongen-terhorst.nl | Bertels BV | Hanneke Ter Horst describes herself as a passionate graphic designer with an eye for detail and a humorous approach to her work. She highlights her experience at Bertels BV, where she supported the growth of the company from 20 to 75 employees and led various graphic projects. The website features examples of her work, including corporate identity, infographics, brochures, website designs and social media visuals. | Merchandise & Retail → Stationery 576 | brand style 276 graphic design 2042 portfolio 6854 | |
| charissavanwaarde.nl | Charissa van Bodegom – van Waarde | Charissa van Bodegom – van Waarde is an artist born in Haarlem and currently lives in Haren (Groningen) where she has her studio. She lives with her husband and two children and a dog. She creates various art forms, including plaster belly casts and busts, which are then decorated with paint or mosaic. She also paints wooden chests and creates murals and guest books. The website provides an overview of her recent projects and serves as a contact point for interested parties. | Painting → Various Techniques 11 | mosaic 213 pregnancy 2739 paintings 3907 | North-Holland → Haarlem 8674 |
| cartoonblanche.nl | Cartoon Blanche | Cartoon Blanche helps organizations create cartoons that illustrate core values, strategies, and upcoming changes. The website offers various services, including cartoons, cartoon infographics, and comic strips, suitable for online media and print. Cartoon Blanche focuses on visual communication for both large and small organizations and provides a satisfaction guarantee without unexpected costs. | Communication → Visual Communication 409 | comic strip 13 cartoon 160 vision 1882 message 2260 illustration 2447 communication 10162 | |
| maisonanimale.nl | Maison Animale | Customers can upload a photo of their pet, after which artists create a unique design. The process includes sending a preview of the design within 48 hours, with the option to make adjustments until the final result is achieved. The website offers various costumes, such as 'The Admiral' and 'The General', and delivers the final canvas or poster within 1-3 days. | Arts → Decorative Arts & Crafts 825 | costume 500 canvas 694 pet 1617 image 2605 portrait 3685 design 27202 | |
| vandijkvk.nl | Van Dijk vormgeving & kartografie | The company has extensive experience with educational cartographic illustrations and working with geographical data. They offer cartographic advice, editing, and production of map materials, with a particular focus on using MAPublisher and other software. These illustrations can be used for various purposes, such as print, apps, and other digital media. | Context 161394 | gis 106 illustration 2447 | Heusden → Vlijmen 389 |
| vanginderenart.nl | Van Ginderen Art | The artworks are hand-drawn with graphite pencils by architect Steven van Ginderen and are available as high-quality art prints. The website sells prints of iconic buildings such as the Domtoren, the Great Church, the Gevangenpoort, Tullepetaon and Peperbus, and well-known towers in Lucca and Florence. Visitors can request a personal drawing or order an existing print, allowing them to acquire unique artworks for their home or office. | | illustration 2447 building 3204 print 5511 | North-Brabant → Bergen op Zoom 2274 |
| mirjahoogstra.nl | Mirja Hoogstra | Mirja Hoogstra creates unique lino prints suitable for decoration or as a gift. Customers can also have a custom design made. The website provides information on shipping costs and methods within the Netherlands, Belgium, and Germany. | Food → Gifts & Souvenirs 2421 | ship 5103 gift 6442 design 27202 | |
| hacq.nl | Hacquebard Grafimedia | Since 1974, Hacquebard Grafimedia has been providing printing services in all shapes and sizes. The company offers high-quality printing at competitive prices, which is recognized in the market. The website showcases various printing options, including branded printing, promotional printing, family printing, and cards for special occasions. | | print 5511 | |
| puddings.nl | Puddings.nl | The website offers a gallery with recent paintings of the artist, who initially was an alias for pinball machine playing. The content describes the period of ‘pud-things,’ which came from the creative challenges of painting. The website also gives a short background about the birth cards of the father, which caused a temporary interruption in production. | Painting → Digital Art 820 | birth card 69 gallery 1983 paint 8747 | |
| rangata.nl | Dave | Dave describes himself as the ‘jester of the digital court’, using the ‘Sacred Pixel Granate’ to create visual chaos with a nod to Monty Python. The website presents various creative compositions, including graphic design, image editing, and an experiment with 3D design. Dave’s work is inspired by Saul Bass and his philosophy of creating beautiful things, even if no one cares. | Humor → Satire 16 | pixel 18 humor 353 composition 639 challenge 1697 color 4159 design 27202 | |
| cjnech.nl | CJ Nech | Cj Nech, operating under the designer name Connie, creates designs spanning from initial concepts to final prints, utilizing tools like pencils, sketchbooks, and Illustrator. The portfolio highlights various projects, including children’s books, wall stickers, and graphics for diverse companies, with a particular focus on her own brand, Sjaapie. Sjaapie, a children's brand, features a brave sheep character and a colorful world of adventures, accompanied by illustrations, stationery designs, and promotional materials. | Children’s Books → Picture Books 90 | sketchbook 33 children's books 83 graphics 123 illustration 2447 brand 17737 design 27202 | |
| lauffercartoons.nl | Lauffer Cartoons | René Lauffer is a cartoonist specializing in simplifying complex topics through humorous metaphors. The website features a portfolio of the cartoons he has created for various organizations and individuals. Visitors can contact Lauffer to discuss their cartooning needs. | Arts → Comics & Illustration 283 | cartoon 160 work 3122 paint 8747 | |
| le-bureau.nl | le bureau | Carla Buijsman, the owner, has over twenty years of experience as a graphic designer and emphasizes conceptual thinking, problem-solving, and fair prices. Le bureau offers services such as designing logos, brand identities, envelopes, stationery, brochures, vehicle lettering, print and online magazines, and digital presentations. The studio also offers brand guardianship, which is essential for maintaining a consistent and professional corporate appearance. | Design → Graphic Design 2433 | brand identity 1457 presentation 1785 magazine 2182 logo 4660 communication 10162 design 27202 | |
| adaenpietbouman.nl | Ada Bouman | The site offers a portfolio of mandalas, drawings, and other creative works, including zendala's, seed circles and holograms. Ada Bouman offers courses and workshops focused on drawing mandalas. In addition to artwork, the website also presents recipes free of gluten, sugar, and E-numbers, and provides reflections and contemplations. | Painting → Digital Art 820 | mandala 93 angel 110 drawing 1101 recipe 5142 course 14728 | |
| stackstattoos.nl | STACKS Studio | STACKS studio offers a diverse range of tattoo styles, including delicate fine line designs, bold blackwork, and intricate dotwork, catering to various aesthetic preferences. The studio's artists, Yung Stacks, Levi Jake, and 66 Onions, each possess unique artistic styles and expertise, capable of bringing custom designs to life on the client’s skin. In addition to tattoo services, the website features a magazine titled 'FLASHSHEET,' a collection of images and concepts representing the studio’s lifestyle and artistic vision, alongside studio details and contact information. | Art Forms → Tattoos 381 | tattoo 799 magazine 2182 studio 5465 artist 5745 design 27202 | South-Holland → Rotterdam 25048 |
| ateliermonique.nl | Atelier Monique | Monique Touwen is an artist and coach who believes in possibilities and has learned from Jesus to turn challenges into blessings. The website describes various workshops and a 'Feeling Creatively' course, focused on discovering personal movement and visual language. Monique creates paintings using acrylic and oil paints, and etchings by directly drawing onto the plate to preserve the character of the drawing. | Painting → Acrylic Painting 547 | etchings 76 acrylic 506 paintings 3907 workshop 19325 coach 25810 | |
| website.onderstoom.nl | Stoomgroep Holland | The association focuses on the builders of steam-driven models, technical tools, and other steam vehicles. The association's magazine ‘Onder Stoom’ publishes descriptions of models, construction drawings, and drawings made by members. Stoomgroep Holland offers various tools, such as hand taps and hand presses, and has a technical forum where members can share knowledge. | Hobbies → Model Building 1007 | steam engine 11 model building 183 drawing 1101 magazine 2182 | |
| webshop.sign4sign.nl | sign4sign | The platform offers a wide range of products including cutting film, print media, adhesive tape and films for various applications, such as textiles, protection and interiors. sign4sign provides an upload module, artwork tips and an FAQ section to support users in the material ordering process. The website also contains information about print productions, tools and accessories, and offers a simple way to place and manage orders. | | print media 29 film 3007 tool 3907 order 6912 | Westerkwartier → Zevenhuizen 460 |